• Gene id: 22865

Gene Summary

• Gene Symbol: SLITRK3   Gene   UCSC   Ensembl
• Gene name: SLIT and NTRK like family member 3
• Alternate names: SLIT and NTRK-like protein 3, slit and trk like gene 3,
• Gene location: 3q26.1 (165197108: 165186719)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the Slitrk family of structurally related transmembrane proteins that are involved in controlling neurite outgrowth. The encoded protein contains two leucine-rich repeat (LRR) domains and a C-terminal domain that is partially
• OMIM: 606838

Protein Summary

• Protein general information: O94933  
  • Name: SLIT and NTRK like protein 3
  • Length: 977  
  • Mass: 108934
  • Tissue specificity: Expressed in the occipital lobe of the cerebral cortex of the brain. Expressed at higher levels in some astrocytic brain tumors such as astrocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumor
• Sequence:

  MKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPCFDPCYCEVKESLFHIHCDSKGFTNISQITEF
  WSRPFKLYLQRNSMRKLYTNSFLHLNNAVSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLES
  LEYLQADYNVIKRIESGAFRNLSKLRVLILNDNLIPMLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIGRSLM
  ELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIRKTELCPLLSDSEVEASLGIPHSSS
  SKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQPRTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPT
  GCTCNLHINDLGLTVNCKERGFNNISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLGNNRISYVQDG
  AFINLPNLKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLLRTLPTDAFA
  GTSLARLNLRKNYFLYLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQWIETISSVSVVGDVLCRSPENLTHR
  DVRTIELEVLCPEMLHVAPAGESPAQPGDSHLIGAPTSASPYEFSPPGGPVPLSVLILSLLVLFFSAVFVAAGLF
  AYVLRRRRKKLPFRSKRQEGVDLTGIQMQCHRLFEDGGGGGGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQM
  CNNPIYKPREEEEVAVSSAQEAGSAERGGPGTQPPGMGEALLGSEQFAETPKENHSNYRTLLEKEKEWALAVSSS
  QLNTIVTVNHHHPHHPAVGGVSGVVGGTGGDLAGFRHHEKNGGVVLFPPGGGCGSGSMLLDRERPQPAPCTVGFV
  DCLYGTVPKLKELHVHPPGMQYPDLQQDARLKETLLFSAGKGFTDHQTQKSDYLELRAKLQTKPDYLEVLEKTTY
  RF

• Structural information:
  • Protein Domains: (232..28-)
    (/note="LRRCT-1)
    (364..40-)
    (/note="LRRNT-)
    (562..61-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • STRING: ENSP00000420091
• Other Databases: GeneCards:  SLITRK3  Malacards:  SLITRK3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007409	axonogenesis	IBA	biological process
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:0099560	synaptic membrane adhesion	IDA	biological process
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IMP	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component
GO:0099060	integral component of postsynaptic specialization membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881