• Gene id: 2286

Gene Summary

• Gene Symbol: FKBP2   Gene   UCSC   Ensembl
• Aliases: FKBP-13, FKBP13, PPIase
• Gene name: FKBP prolyl isomerase 2
• Alternate names: peptidyl-prolyl cis-trans isomerase FKBP2, 13 kDa FK506-binding protein, 13 kDa FKBP, FK506 binding protein 2, 13kDa, FK506-binding protein 2, PPIase FKBP2, epididymis secretory sperm binding protein, immunophilin FKBP13, proline isomerase, rapamycin-binding prote,
• Gene location: 11q13.1 (64241094: 64244134)     Exons: 9     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds
• OMIM: 611701

Protein Summary

• Protein general information: P26885  
  • Name: Peptidyl prolyl cis trans isomerase FKBP2 (PPIase FKBP2) (EC 5.2.1.8) (13 kDa FK506 binding protein) (13 kDa FKBP) (FKBP 13) (FK506 binding protein 2) (FKBP 2) (Immunophilin FKBP13) (Rotamase)
  • Length: 142  
  • Mass: 15649
  • Tissue specificity: T-cells and thymus.
• Sequence:

  MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQP
  FVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL

• Structural information:
  • Protein Domains: (49..13-)
    (/note="PPIase-FKBP-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00277"-)
  • Interpro: IPR001179  
  • Prosite: PS50059
  • PDB: 2PBC 4NNR
  • PDBsum: 2PBC 4NNR
  • STRING: ENSP00000378046
• Other Databases: GeneCards:  FKBP2  Malacards:  FKBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005528	FK506 binding	TAS	molecular function
GO:0005783	endoplasmic reticulum	TAS	cellular component
GO:0003755	peptidyl-prolyl cis-trans isomerase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process
GO:0000413	protein peptidyl-prolyl isomerization	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881