• Gene id: 22858

Gene Summary

• Gene Symbol: CILK1   Gene   UCSC   Ensembl
• Aliases: ECO, EJM10, ICK, LCK2, MRK, hICK
• Gene name: ciliogenesis associated kinase 1
• Alternate names: serine/threonine-protein kinase ICK, MAK-related kinase, iciliogenesis associated kinase 1, intestinal cell (MAK-like) kinase, intestinal cell kinase, laryngeal cancer kinase 2, serine/threonine protein kinase,
• Gene location: 6p12.1 (53061823: 53001298)     Exons: 18     NC_000006.12
• Gene summary(Entrez): Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harbor
• OMIM: 611453

Protein Summary

• Protein general information: Q9UPZ9  
  • Name: Serine/threonine protein kinase ICK (EC 2.7.11.1) (Ciliogenesis associated kinase 1) (Intestinal cell kinase) (hICK) (Laryngeal cancer kinase 2) (LCK2) (MAK related kinase) (MRK)
  • Length: 632  
  • Mass: 71427
  • Tissue specificity: Expressed in heart, brain, placenta, pancreas, thymus, prostate, testis, ovary, small intestine and colon, with highest levels in placenta and testis. Not detected in spleen. Also expressed in many cancer cell lines. {ECO
• Sequence:

  MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHL
  YFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREI
  RSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWP
  EGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDS
  EKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFP
  SLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCRFE
  SVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYLKHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLS
  GKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHT
  QPRSTPGLIPRPPAAQPVHGRTDWASKYASRR

• Structural information:
  • Protein Domains: (4..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159,-ECO:0000305")
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000349458
• Other Databases: GeneCards:  CILK1  Malacards:  CILK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060271	cilium assembly	IBA	biological process
GO:0042073	intraciliary transport	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005929	cilium	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0036064	ciliary basal body	ISS	cellular component
GO:0042073	intraciliary transport	ISS	biological process
GO:0097542	ciliary tip	IMP	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0097546	ciliary base	ISS	cellular component
GO:0035720	intraciliary anterograde transport	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0035721	intraciliary retrograde transport	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0035720	intraciliary anterograde transport	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0042073	intraciliary transport	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0097542	ciliary tip	IEA	cellular component
GO:0097546	ciliary base	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035721	intraciliary retrograde transport	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0007165	signal transduction	TAS	biological process
GO:0060271	cilium assembly	IBA	biological process
GO:0042073	intraciliary transport	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0010468	regulation of gene expression	IBA	biological process
GO:0005929	cilium	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0036064	ciliary basal body	ISS	cellular component
GO:0042073	intraciliary transport	ISS	biological process
GO:0097542	ciliary tip	IMP	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0097546	ciliary base	ISS	cellular component
GO:0035720	intraciliary anterograde transport	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0035721	intraciliary retrograde transport	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030030	cell projection organization	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0035720	intraciliary anterograde transport	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0042073	intraciliary transport	IEA	biological process
GO:0060271	cilium assembly	IEA	biological process
GO:0097542	ciliary tip	IEA	cellular component
GO:0097546	ciliary base	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0035721	intraciliary retrograde transport	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000287	magnesium ion binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0007165	signal transduction	TAS	biological process

Diseases

Associated diseases	References
Juvenile myoclonic epilepsy	KEGG:H02217
Endocrine-cerebro-osteodysplasia syndrome	KEGG:H00972
Juvenile myoclonic epilepsy	KEGG:H02217
Endocrine-cerebro-osteodysplasia syndrome	KEGG:H00972
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881