• Gene id: 22853

Gene Summary

• Gene Symbol: LMTK2   Gene   UCSC   Ensembl
• Aliases: AATYK2, BREK, KPI-2, KPI2, LMR2, PPP1R100, cprk, hBREK
• Gene name: lemur tyrosine kinase 2
• Alternate names: serine/threonine-protein kinase LMTK2, CDK5/p35-regulated kinase, apoptosis-associated tyrosine kinase 2, brain-enriched kinase, cyclin-dependent kinase 5/p35-regulated kinase, kinase/phosphatase/inhibitor 2, protein phosphatase 1, regulatory subunit 100,,
• Gene location: 7q21.3 (98106867: 98209635)     Exons: 14     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene belongs to the protein kinase superfamily and the protein tyrosine kinase family. It contains N-terminal transmembrane helices and a long C-terminal cytoplasmic tail with serine/threonine/tyrosine kinase activity. This pro
• OMIM: 610989

Protein Summary

• Protein general information: Q8IWU2  
  • Name: Serine/threonine protein kinase LMTK2 (EC 2.7.11.1) (Apoptosis associated tyrosine kinase 2) (Brain enriched kinase) (hBREK) (CDK5/p35 regulated kinase) (CPRK) (Kinase/phosphatase/inhibitor 2) (Lemur tyrosine kinase 2) (Serine/threonine protein kinase KPI
  • Length: 1503  
  • Mass: 164,900
• Sequence:

  MPGPPALRRRLLLLLLVLLIAGSAGAAPLPQTGAGEAPPAAEVSSSFVILCVCSLIILIVLIANCVSCCKDPEID
  FKEFEDNFDDEIDFTPPAEDTPSVQSPAEVFTLSVPNISLPAPSQFQPSVEGLKSQVARHSLNYIQEIGNGWFGK
  VLLGEIYTGTSVARVIVKELKASANPKEQDTFLKNGEPYYILQHPNILQCVGQCVEAIPYLLVFEFCDLGDLKAY
  LRSEQEHMRGDSQTMLLQRMACEVAAGLAAMHKLHFLHSDLALRNCFLTSDLNVKVGDYGIGFSRYKEDYIETDD
  KKVFPLRWTAPELVTSFQDRLLTADQTKYSNIWSLGVTLWELFDNAAQPYSNLSNLDVLNQVIRERDTKLPKPQL
  EQPYSDRWYEVLQFCWLSPEKRPAAEDVHRLLTYLRLQSQRDSEVDFEQQWNALKPNTNSRDSSNNAAFPILDHF
  ARDRLGREMEEVLTVTETSQGLSFEYVWEAAKHDHFDERSRGHLDEGLSYTSIFYPVEVFESSLSDPGPGKQDDS
  GQDVPLRVPGVVPVFDAHNLSVGSDYYIQLEEKSGSNLELDYPPALLTTDMDNPERTGPELSQLTALRSVELEES
  STDEDFFQSSTDPKDSSLPGDLHVTSGPESPFNNIFNDVDKSEDLPSHQKIFDLMELNGVQADFKPATLSSSLDN
  PKESVITGHFEKEKPRKIFDSEPLCLSDNLMHQDNFDPLNVQELSENFLFLQEKNLLKGSLSSKEHINDLQTELK
  NAGFTEAMLETSCRNSLDTELQFAENKPGLSLLQENVSTKGDDTDVMLTGDTLSTSLQSSPEVQVPPTSFETEET
  PRRVPPDSLPTQGETQPTCLDVIVPEDCLHQDISPDAVTVPVEILSTDARTHSLDNRSQDSPGESEETLRLTESD
  SVLADDILASRVSVGSSLPELGQELHNKPFSEDHHSHRRLEKNLEAVETLNQLNSKDAAKEAGLVSALSSDSTSQ
  DSLLEDSLSAPFPASEPSLETPDSLESVDVHEALLDSLGSHTPQKLVPPDKPADSGYETENLESPEWTLHPAPEG
  TADSEPATTGDGGHSGLPPNPVIVISDAGDGHRGTEVTPETFTAGSQGSYRDSAYFSDNDSEPEKRSEEVPGTSP
  SALVLVQEQPLPEPVLPEQSPAAQDSCLEARKSQPDESCLSALHNSSDLELRATPEPAQTGVPQQVHPTEDEASS
  PWSVLNAELSSGDDFETQDDRPCTLASTGTNTNELLAYTNSALDKSLSSHSEGPKLKEPDIEGKYLGKLGVSGML
  DLSEDGMDADEEDENSDDSDEDLRAFNLHSLSSESEDETEHPVPIILSNEDGRHLRSLLKPTAANAPDPLPEDWK
  KEKKAVTFFDDVTVYLFDQETPTKELGPCGGEACGPDLSGPAPASGSPYLSRCINSESSTDEEGGGFEWDDDFSP
  DPFMSKTTSNLLSSKPSLQTSKYFSPPPPARSTEQSWPHSAPYSRFSISPANIASFSLTHLTDSDIEQGGSSEDG
  EKD

• Structural information:
  • Protein Domains: Protein (137-407)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  
  • Prosite: PS00107 PS50011 PS00109
  • STRING: ENSP00000297293
• Other Databases: GeneCards:  LMTK2  Malacards:  LMTK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001881	receptor recycling	IMP	biological process
GO:0001881	receptor recycling	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0032456	endocytic recycling	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0070853	myosin VI binding	IPI	molecular function
GO:0070853	myosin VI binding	IPI	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001881	receptor recycling	IMP	biological process
GO:0001881	receptor recycling	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0032456	endocytic recycling	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0043086	negative regulation of catalytic activity	IEA	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0070853	myosin VI binding	IPI	molecular function
GO:0070853	myosin VI binding	IPI	molecular function
GO:0001881	receptor recycling	IMP	biological process
GO:0001881	receptor recycling	IMP	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004864	protein phosphatase inhibitor activity	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	NAS	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0016021	integral component of membrane	IDA	cellular component
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0032456	endocytic recycling	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0033572	transferrin transport	IMP	biological process
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0055037	recycling endosome	IDA	cellular component
GO:0070853	myosin VI binding	IPI	molecular function
GO:0070853	myosin VI binding	IPI	molecular function

Diseases

Associated diseases	References
Cancer	GAD: 19767753
Cancer (prostate)	GAD: 19366831
Cardiovascular disease	GAD: 17903301
Male factor infertility	MIK: 19806447
Meiotic arrest	MIK: 19806447
Azoospermia	MIK: 19806447
Chronic renal failure	GAD: 21085059
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 17158803
Male infertility	MIK: 17158803
Meiotic arrest	MIK: 19806447
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
19806447	Azoospermia, meiotic arrest	LMTK2(381 C/G:Pro/Ala, 2371T/C Ile/Thr, 2631T/A Leu/Met, 2726G/A Synonymous GA, 2726G/A Synonymous GA, 3164C/T Synonymous CT, 3641G/A Synonymous GA, 4145A/G Synonymous AG, 5277T/C 3?UTR TC ), PARP (1159C/T Synonymous, 1359G/A Arg/Gln, 1469A/C Asn/His, 178	Japanes e	18 Japanese men with azoospermia	Male infertility	LMTK2 PARP-2
17158803	Azoospermia, Male infertility				Male infertility
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq