• Gene id: 22849

Gene Summary

• Gene Symbol: CPEB3   Gene   UCSC   Ensembl
• Gene name: cytoplasmic polyadenylation element binding protein 3
• Alternate names: cytoplasmic polyadenylation element-binding protein 3, CPE-BP3, CPE-binding protein 3, hCPEB-3,
• Gene location: 10q23.32 (92291498: 92046691)     Exons: 17     NC_000010.11
• OMIM: 610606

Protein Summary

• Protein general information: Q8NE35  
  • Name: Cytoplasmic polyadenylation element binding protein 3 (CPE BP3) (CPE binding protein 3) (hCPEB 3)
  • Length: 698  
  • Mass: 76014
• Sequence:

  MQDDLLMDKSKTQPQPQQQQRQQQQPQPESSVSEAPSTPLSSETPKPEENSAVPALSPAAAPPAPNGPDKMQMES
  PLLPGLSFHQPPQQPPPPQEPAAPGASLSPSFGSTWSTGTTNAVEDSFFQGITPVNGTMLFQNFPHHVNPVFGGT
  FSPQIGLAQTQHHQQPPPPAPAPQPAQPAQPPQAQPPQQRRSPASPSQAPYAQRSAAAAYGHQPIMTSKPSSSSA
  VAAAAAAAAASSASSSWNTHQSVNAAWSAPSNPWGGLQAGRDPRRAVGVGVGVGVGVPSPLNPISPLKKPFSSNV
  IAPPKFPRAAPLTSKSWMEDNAFRTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSGPP
  MSFADIMWRNHFAGRMGINFHHPGTDNIMALNNAFLDDSHGDQALSSGLSSPTRCQNGERVERYSRKVFVGGLPP
  DIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACLEEDGKLYLCVSSPTIKDKPV
  QIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSN
  QQSYIAAISARFVQLQHNDIDKRVEVKPYVLDDQMCDECQGTRCGGKFAPFFCANVTCLQYYCEYCWASIHSRAG
  REFHKPLVKEGGDRPRHVPFRWS

• Structural information:
  • Protein Domains: (441..53-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (549..63-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR032296  IPR038446  IPR034819  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • PDB: 2DNL 2RUG
  • PDBsum: 2DNL 2RUG
  • STRING: ENSP00000482128
• Other Databases: GeneCards:  CPEB3  Malacards:  CPEB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008135	translation factor activity, RNA binding	IBA	molecular function
GO:0043005	neuron projection	IBA	cellular component
GO:0043022	ribosome binding	IBA	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0045202	synapse	IBA	cellular component
GO:1990124	messenger ribonucleoprotein complex	IBA	cellular component
GO:2000766	negative regulation of cytoplasmic translation	IBA	biological process
GO:0071230	cellular response to amino acid stimulus	IDA	biological process
GO:0071230	cellular response to amino acid stimulus	IDA	biological process
GO:0043005	neuron projection	IDA	cellular component
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0017148	negative regulation of translation	IDA	biological process
GO:0017148	negative regulation of translation	IDA	biological process
GO:0008135	translation factor activity, RNA binding	IDA	molecular function
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:1900248	negative regulation of cytoplasmic translational elongation	ISS	biological process
GO:0097440	apical dendrite	ISS	cellular component
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0060999	positive regulation of dendritic spine development	ISS	biological process
GO:0060998	regulation of dendritic spine development	ISS	biological process
GO:0048167	regulation of synaptic plasticity	ISS	biological process
GO:0045727	positive regulation of translation	ISS	biological process
GO:0043005	neuron projection	ISS	cellular component
GO:0035925	mRNA 3'-UTR AU-rich region binding	ISS	molecular function
GO:0035613	RNA stem-loop binding	ISS	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0008135	translation factor activity, RNA binding	ISS	molecular function
GO:0007616	long-term memory	ISS	biological process
GO:1900365	positive regulation of mRNA polyadenylation	ISS	biological process
GO:0045202	synapse	ISS	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0000900	translation repressor activity, mRNA regulatory element binding	ISS	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0045182	translation regulator activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0006417	regulation of translation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006412	translation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)