• Gene id: 22846

Gene Summary

• Gene Symbol: VASH1   Gene   UCSC   Ensembl
• Aliases: KIAA1036, TTCP 1
• Gene name: vasohibin 1
• Alternate names: tubulinyl-Tyr carboxypeptidase 1, tubulin carboxypeptidase 1, tyrosine carboxypeptidase 1,
• Gene location: 14q24.3 (76761456: 76783016)     Exons: 9     NC_000014.9
• OMIM: 617503

Protein Summary

• Protein general information: Q7L8A9  
  • Name: Tubulinyl Tyr carboxypeptidase 1 (EC 3.4.17.17) (Tubulin carboxypeptidase 1) (Tyrosine carboxypeptidase 1) (TTCP 1) (Vasohibin 1)
  • Length: 365  
  • Mass: 40957
  • Tissue specificity: Preferentially expressed in endothelial cells (PubMed
• Sequence:

  MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWE
  RMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPL
  TGLMDLAKEMTKEALPIKCLEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVNFAGRYGALGMSRRED
  LMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLGQSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARD
  MRLKIGKGTGPPSPTKDRKKDVSSPQRAQSSPHRRNSRSERRPSGDKKTSEPKAMPDLNGYQIRV

• Structural information:
  • Interpro: IPR028131  IPR028132  
  • PDB: 6J4U 6J7B 6J8F 6J8N 6J8O 6J91 6J9H 6NVQ 6OCF 6OCG 6OCH
  • PDBsum: 6J4U 6J7B 6J8F 6J8N 6J8O 6J91 6J9H 6NVQ 6OCF 6OCG 6OCH
  • STRING: ENSP00000167106
• Other Databases: GeneCards:  VASH1  Malacards:  VASH1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IBA	cellular component
GO:0045765	regulation of angiogenesis	IBA	biological process
GO:0003779	actin binding	IDA	molecular function
GO:0006508	proteolysis	IDA	biological process
GO:0004181	metallocarboxypeptidase activity	IDA	molecular function
GO:0004181	metallocarboxypeptidase activity	IMP	molecular function
GO:0004181	metallocarboxypeptidase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001937	negative regulation of endothelial cell proliferation	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045765	regulation of angiogenesis	IEA	biological process
GO:0006508	proteolysis	IEA	biological process
GO:0007050	cell cycle arrest	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004180	carboxypeptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0045177	apical part of cell	IDA	cellular component
GO:0009611	response to wounding	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process
GO:0001525	angiogenesis	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:1901491	negative regulation of lymphangiogenesis	IGI	biological process
GO:1901491	negative regulation of lymphangiogenesis	IGI	biological process
GO:0016525	negative regulation of angiogenesis	IGI	biological process
GO:0010596	negative regulation of endothelial cell migration	IGI	biological process
GO:2000772	regulation of cellular senescence	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003779	actin binding	IEA	molecular function
GO:0004181	metallocarboxypeptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016525	negative regulation of angiogenesis	IEA	biological process
GO:0060674	placenta blood vessel development	IEA	biological process
GO:0060716	labyrinthine layer blood vessel development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0001937	negative regulation of endothelial cell proliferation	IDA	biological process

Diseases

Associated diseases	References
Portal hypertension	PMID:24390792
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq