• Gene id: 22843

Gene Summary

• Gene Symbol: PPM1E   Gene   UCSC   Ensembl
• Aliases: CaMKP-N, POPX1, PP2CH, caMKN
• Gene name: protein phosphatase, Mg2+/Mn2+ dependent 1E
• Alternate names: protein phosphatase 1E, ca(2+)/calmodulin-dependent protein kinase phosphatase N, caMKP-nucleus, nuclear calmodulin-dependent protein kinase phosphatase, partner of PIX 1, partner of PIX-alpha, partner of PIXA, protein phosphatase 1E (PP2C domain containing),
• Gene location: 17q22 (58755853: 58985616)     Exons: 9     NC_000017.11
• Gene summary(Entrez): This gene encodes a member of the PPM family of serine/threonine-protein phosphatases. The encoded protein is localized to the nucleus and dephosphorylates and inactivates multiple substrates including serine/threonine-protein kinase PAK 1, 5'-AMP-activat

Protein Summary

• Protein general information: Q8WY54  
  • Name: Protein phosphatase 1E (EC 3.1.3.16) (Ca(2+)/calmodulin dependent protein kinase phosphatase N) (CaMKP N) (CaMKP nucleus) (CaMKN) (Partner of PIX 1) (Partner of PIX alpha) (Partner of PIXA)
  • Length: 755  
  • Mass: 83952
• Sequence:

  MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPEPELVEAEAAEASVEEPGEEAATVAA
  TEEGDQEQDPEPEEEAAVEGEEEEEGAATAAAAPGHSAVPPPPPQLPPLPPLPRPLSERITREEVEGESLDLCLQ
  QLYKYNCPSFLAAALARATSDEVLQSDLSAHYIPKETDGTEGTVEIETVKLARSVFSKLHEICCSWVKDFPLRRR
  PQLYYETSIHAIKNMRRKMEDKHVCIPDFNMLFNLEDQEEQAYFAVFDGHGGVDAAIYASIHLHVNLVRQEMFPH
  DPAEALCRAFRVTDERFVQKAARESLRCGTTGVVTFIRGNMLHVAWVGDSQVMLVRKGQAVELMKPHKPDREDEK
  QRIEALGGCVVWFGAWRVNGSLSVSRAIGDAEHKPYICGDADSASTVLDGTEDYLILACDGFYDTVNPDEAVKVV
  SDHLKENNGDSSMVAHKLVASARDAGSSDNITVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGEC
  KRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLEDPGYLDLTQIEASKPHSAQFLLPVEMFGPGAPKKA
  NLINELMMEKKSVQSSLPEWSGAGEFPTAFNLGSTGEQIYRMQSLSPVCSGLENEQFKSPGNRVSRLSHLRHHYS
  KKWHRFRFNPKFYSFLSAQEPSHKIGTSLSSLTGSGKRNRIRSSLPWRQNSWKGYSENMRKLRKTHDIPCPDLPW
  SYKIE

• Structural information:
  • Protein Domains: (231..48-)
    (/note="PPM-type-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01082"-)
  • Interpro: IPR015655  IPR000222  IPR036457  IPR001932  
  • Prosite: PS01032 PS51746
  • CDD: cd00143
  • STRING: ENSP00000312411
• Other Databases: GeneCards:  PPM1E  Malacards:  PPM1E

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0004724	magnesium-dependent protein serine/threonine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0043169	cation binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0004722	protein serine/threonine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0035970	peptidyl-threonine dephosphorylation	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0004722	protein serine/threonine phosphatase activity	IDA	molecular function
GO:0051496	positive regulation of stress fiber assembly	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0035690	cellular response to drug	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray