• Gene id: 22841

Gene Summary

• Gene Symbol: RAB11FIP2   Gene   UCSC   Ensembl
• Aliases: Rab11-FIP2, nRip11
• Gene name: RAB11 family interacting protein 2
• Alternate names: rab11 family-interacting protein 2, RAB11 family interacting protein 2 (class I), RAB11-FIP2 long isoform,
• Gene location: 10q26.11 (118046940: 118004915)     Exons: 7     NC_000010.11
• OMIM: 608599

Protein Summary

• Protein general information: Q7L804  
  • Name: Rab11 family interacting protein 2 (Rab11 FIP2) (NRip11)
  • Length: 512  
  • Mass: 58279
• Sequence:

  MMLSEQAQKWFPTHVQVTVLQAKDLKPKGKSGTNDTYTIIQLGKEKYSTSVAEKTLEPVWKEEASFELPGLLIQG
  SPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWFRLESKQGKRIKNRGEIKVNIQFMRNNMTAS
  MFDLSMKDKTRSPFAKLKDKMKGRKNDGTFSDTSSAIIPSTHMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSA
  HSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMNQPDSIVDEGELCFGRQ
  NDPFTNVTASLPQKFATLPRKKNPFEESSETWDSSMNLFSKPIEIRKENKREKREKVSLFERVTGKKDSRRSDKL
  NNGGSDSPCDLKSPNAFSENRQDYFDYESTNPFTAKFRASNIMPSSSFHMSPTSNEDLRKIPDSNPFDATAGYRS
  LTYEEVLQELVKHKELLRRKDTHIRELEDYIDNLLVRVMEETPSILRVPYEPSRKAGKFSNS

• Structural information:
  • Protein Domains: (1..12-)
    (/note="C2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (437..49-)
    (/note="FIP-RBD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00844"-)
  • Interpro: IPR000008  IPR035892  IPR037245  IPR037789  IPR019018  
  • Prosite: PS50004 PS51511
  • PDB: 2GZD 2GZH 2K6S 3TSO 4C4P
  • PDBsum: 2GZD 2GZH 2K6S 3TSO 4C4P
  • DIP: 29139
  • STRING: ENSP00000347839
• Other Databases: GeneCards:  RAB11FIP2  Malacards:  RAB11FIP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001891	phagocytic cup	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0017137	Rab GTPase binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0045055	regulated exocytosis	IBA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0035669	TRAM-dependent toll-like receptor 4 signaling pathway	IDA	biological process
GO:0001891	phagocytic cup	IDA	cellular component
GO:0043547	positive regulation of GTPase activity	IDA	biological process
GO:0045055	regulated exocytosis	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	ISS	biological process
GO:0030010	establishment of cell polarity	IMP	biological process
GO:0006909	phagocytosis	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0003091	renal water homeostasis	TAS	biological process
GO:0030659	cytoplasmic vesicle membrane	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045055	regulated exocytosis	IEA	biological process
GO:0035773	insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:1903078	positive regulation of protein localization to plasma membrane	IEA	biological process
GO:0001891	phagocytic cup	IEA	cellular component
GO:0055038	recycling endosome membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881