• Gene id: 22829

Gene Summary

• Gene Symbol: NLGN4Y   Gene   UCSC   Ensembl
• Aliases: HNL4Y
• Gene name: neuroligin 4 Y-linked
• Alternate names: neuroligin-4, Y-linked, alternative HNL4Y,
• Gene location: Yq11.221 (14522615: 14845653)     Exons: 2     NC_000024.10
• Gene summary(Entrez): This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced
• OMIM: 400028

Protein Summary

• Protein general information: Q8NFZ3  
  • Name: Neuroligin 4, Y linked (Neuroligin Y)
  • Length: 816  
  • Mass: 92021
  • Tissue specificity: Expressed in fetal and adult brain, prostate and testis. {ECO
• Sequence:

  MLRPQGLLWLPLLFTSVCVMLNSNVLLWITALAIKFTLIDSQAQYPVVNTNYGKIQGLRTPLPSEILGPVEQYLG
  VPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLN
  IYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLL
  DQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRIL
  ADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGE
  GLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWV
  APAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMT
  YWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNL
  NEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTEL
  SVTIAVGASLLFLNILAFAALYYKKDKRRHETHRHPSPQRNTTNDITHIQNEEIMSLQMKQLEHDHECESLQAHD
  TLRLTCPPDYTLTLRRSPDDIPFMTPNTITMIPNTLMGMQPLHTFKTFSGGQNSTNLPHGHSTTRV

• Structural information:
  • Interpro: IPR029058  IPR002018  IPR019819  IPR000460  IPR030025  
  • Prosite: PS00941
• Other Databases: GeneCards:  NLGN4Y  Malacards:  NLGN4Y

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099054	presynapse assembly	TAS	biological process
GO:0098985	asymmetric, glutamatergic, excitatory synapse	TAS	cellular component
GO:0098983	symmetric, GABA-ergic, inhibitory synapse	TAS	cellular component
GO:0089717	spanning component of membrane	TAS	cellular component
GO:0097105	presynaptic membrane assembly	IBA	biological process
GO:0097104	postsynaptic membrane assembly	IBA	biological process
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0048488	synaptic vesicle endocytosis	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0042043	neurexin family protein binding	IBA	molecular function
GO:0009986	cell surface	IBA	cellular component
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0007158	neuron cell-cell adhesion	IBA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042043	neurexin family protein binding	IEA	molecular function
GO:0045202	synapse	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0097110	scaffold protein binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	TAS	molecular function
GO:0007158	neuron cell-cell adhesion	TAS	biological process
GO:0035176	social behavior	IMP	biological process
GO:0007612	learning	IMP	biological process
GO:0071625	vocalization behavior	IMP	biological process
GO:0098839	postsynaptic density membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0098793	presynapse	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)