• Gene id: 22823

Gene Summary

• Gene Symbol: MTF2   Gene   UCSC   Ensembl
• Aliases: M96, PCL2, TDRD19A, dJ976O13.2
• Gene name: metal response element binding transcription factor 2
• Alternate names: metal-response element-binding transcription factor 2, hPCl2, metal regulatory transcription factor 2, metal-response element DNA-binding protein M96, polycomb-like 2, polycomb-like protein 2, putative DNA binding protein, tudor domain containing 19A,
• Gene location: 1p22.1 (93079234: 93139080)     Exons: 16     NC_000001.11

Protein Summary

• Protein general information: Q9Y483  
  • Name: Metal response element binding transcription factor 2 (Metal regulatory transcription factor 2) (Metal response element DNA binding protein M96) (Polycomb like protein 2) (hPCl2)
  • Length: 593  
  • Mass: 67090
• Sequence:

  MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQS
  CFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWL
  CRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQW
  FHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENW
  DRLHPGELADTPKSERYEHVLEALNDYKTMFMSGKEIKKKKHLFGLRIRVPPVPPNVAFKAEKEPEGTSHEFKIK
  GRKASKPISDSREVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSN
  TSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDY
  QFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS

• Structural information:
  • Protein Domains: (44..10-)
    (/note="Tudor"-)
  • Interpro: IPR040477  IPR025894  IPR042014  IPR042015  IPR002999   IPR019786  IPR011011  IPR001965  IPR019787  IPR013083  
  • Prosite: PS01359 PS50016
  • CDD: cd15578 cd15580
  • PDB: 5XFR
  • PDBsum: 5XFR
  • STRING: ENSP00000359321
• Other Databases: GeneCards:  MTF2  Malacards:  MTF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IBA	molecular function
GO:0006325	chromatin organization	IBA	biological process
GO:0035064	methylated histone binding	IBA	molecular function
GO:0035098	ESC/E(Z) complex	IBA	colocalizes with
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0035064	methylated histone binding	IDA	molecular function
GO:0048863	stem cell differentiation	ISS	biological process
GO:0035098	ESC/E(Z) complex	ISS	colocalizes with
GO:0061087	positive regulation of histone H3-K27 methylation	ISS	biological process
GO:0061086	negative regulation of histone H3-K27 methylation	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0019827	stem cell population maintenance	ISS	biological process
GO:0007379	segment specification	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045814	negative regulation of gene expression, epigenetic	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0048863	stem cell differentiation	IEA	biological process
GO:0035098	ESC/E(Z) complex	IEA	cellular component
GO:0035064	methylated histone binding	IEA	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0061087	positive regulation of histone H3-K27 methylation	IEA	biological process
GO:0061086	negative regulation of histone H3-K27 methylation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0007379	segment specification	IEA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0006325	chromatin organization	IBA	biological process
GO:0035064	methylated histone binding	IBA	molecular function
GO:0035098	ESC/E(Z) complex	IBA	colocalizes with
GO:0003677	DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0035064	methylated histone binding	IDA	molecular function
GO:0048863	stem cell differentiation	ISS	biological process
GO:0035098	ESC/E(Z) complex	ISS	colocalizes with
GO:0061087	positive regulation of histone H3-K27 methylation	ISS	biological process
GO:0061086	negative regulation of histone H3-K27 methylation	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0019827	stem cell population maintenance	ISS	biological process
GO:0007379	segment specification	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0045814	negative regulation of gene expression, epigenetic	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0048863	stem cell differentiation	IEA	biological process
GO:0035098	ESC/E(Z) complex	IEA	cellular component
GO:0035064	methylated histone binding	IEA	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0061087	positive regulation of histone H3-K27 methylation	IEA	biological process
GO:0061086	negative regulation of histone H3-K27 methylation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0007379	segment specification	IEA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881