• Gene id: 22818

Gene Summary

• Gene Symbol: COPZ1   Gene   UCSC   Ensembl
• Aliases: CGI-120, COPZ, HSPC181, zeta-COP, zeta1-COP
• Gene name: COPI coat complex subunit zeta 1
• Alternate names: coatomer subunit zeta-1, coatomer protein complex subunit zeta 1, coatomer protein complex, subunit zeta, zeta-1 COP, zeta-1-coat protein,
• Gene location: 12q13.13 (54325108: 54351849)     Exons: 9     NC_000012.12
• Gene summary(Entrez): This gene encodes a subunit of the cytoplasmic coatamer protein complex, which is involved in autophagy and intracellular protein trafficking. The coatomer protein complex is comprised of seven subunits and functions as the coat protein of coat protein co
• OMIM: 615472

Protein Summary

• Protein general information: P61923  
  • Name: Coatomer subunit zeta 1 (Zeta 1 coat protein) (Zeta 1 COP)
  • Length: 177  
  • Mass: 20198
• Sequence:

  MEALILEPSLYTVKAILILDNDGDRLFAKYYDDTYPSVKEQKAFEKNIFNKTHRTDSEIALLEGLTVVYKSSIDL
  YFYVIGSSYENELMLMAVLNCLFDSLSQMLRKNVEKRALLENMEGLFLAVDEIVDGGVILESDPQQVVHRVALRG
  EDVPLTEQTVSQVLQSAKEQIKWSLLR

• Structural information:
  • Interpro: IPR022775  IPR000804  IPR039652  IPR011012  
  • Prosite: PS00989
  • PDB: 2HF6 5MC7
  • PDBsum: 2HF6 5MC7
  • DIP: 29873
  • STRING: ENSP00000449270
• Other Databases: GeneCards:  COPZ1  Malacards:  COPZ1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006891	intra-Golgi vesicle-mediated transport	IBA	biological process
GO:0030126	COPI vesicle coat	IBA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA	biological process
GO:0030117	membrane coat	IEA	cellular component
GO:0030126	COPI vesicle coat	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030663	COPI-coated vesicle membrane	IEA	cellular component
GO:0006891	intra-Golgi vesicle-mediated transport	IDA	biological process
GO:0030126	COPI vesicle coat	IDA	cellular component
GO:0030126	COPI vesicle coat	ISS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0006891	intra-Golgi vesicle-mediated transport	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881