• Gene id: 22803

Gene Summary

• Gene Symbol: XRN2   Gene   UCSC   Ensembl
• Gene name: 5'-3' exoribonuclease 2
• Alternate names: 5'-3' exoribonuclease 2, DHP protein, Dhm1-like protein,
• Gene location: 20p11.22 (21303312: 21389824)     Exons: 32     NC_000020.11
• Gene summary(Entrez): This gene encodes a 5'-3' exonuclease that promotes transcription termination at cotranscriptional cleavage sites. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
• OMIM: 608851

Protein Summary

• Protein general information: Q9H0D6  
  • Name: 5' 3' exoribonuclease 2 (EC 3.1.13. ) (DHM1 like protein) (DHP protein)
  • Length: 950  
  • Mass: 108582
  • Tissue specificity: Expressed in the spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocytes, heart, brain, placenta, lung, liver, skeletal muscle, kidney, and pancreas. Isoform 2 is expressed predominantly in peripher
• Sequence:

  MGVPAFFRWLSRKYPSIIVNCVEEKPKECNGVKIPVDASKPNPNDVEFDNLYLDMNGIIHPCTHPEDKPAPKNED
  EMMVAIFEYIDRLFSIVRPRRLLYMAIDGVAPRAKMNQQRSRRFRASKEGMEAAVEKQRVREEILAKGGFLPPEE
  IKERFDSNCITPGTEFMDNLAKCLRYYIADRLNNDPGWKNLTVILSDASAPGEGEHKIMDYIRRQRAQPNHDPNT
  HHCLCGADADLIMLGLATHEPNFTIIREEFKPNKPKPCGLCNQFGHEVKDCEGLPREKKGKHDELADSLPCAEGE
  FIFLRLNVLREYLERELTMASLPFTFDVERSIDDWVFMCFFVGNDFLPHLPSLEIRENAIDRLVNIYKNVVHKTG
  GYLTESGYVNLQRVQMIMLAVGEVEDSIFKKRKDDEDSFRRRQKEKRKRMKRDQPAFTPSGILTPHALGSRNSPG
  SQVASNPRQAAYEMRMQNNSSPSISPNTSFTSDGSPSPLGGIKRKAEDSDSEPEPEDNVRLWEAGWKQRYYKNKF
  DVDAADEKFRRKVVQSYVEGLCWVLRYYYQGCASWKWYYPFHYAPFASDFEGIADMPSDFEKGTKPFKPLEQLMG
  VFPAASGNFLPPSWRKLMSDPDSSIIDFYPEDFAIDLNGKKYAWQGVALLPFVDERRLRAALEEVYPDLTPEETR
  RNSLGGDVLFVGKHHPLHDFILELYQTGSTEPVEVPPELCHGIQGKFSLDEEAILPDQIVCSPVPMLRDLTQNTV
  VSINFKDPQFAEDYIFKAVMLPGARKPAAVLKPSDWEKSSNGRQWKPQLGFNRDRRPVHLDQAAFRTLGHVMPRG
  SGTGIYSNAAPPPVTYQGNLYRPLLRGQAQIPKLMSNMRPQDSWRGPPPLFQQQRFDRGVGAEPLLPWNRMLQTQ
  NAAFQPNQYQMLAGPGGYPPRRDDRGGRQGYPREGRKYPLPPPSGRYNWN

• Structural information:
  • Interpro: IPR027073  IPR004859  IPR041412  IPR017151  
  • DIP: 31166
  • STRING: ENSP00000366396
• Other Databases: GeneCards:  XRN2  Malacards:  XRN2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004534	5'-3' exoribonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0000956	nuclear-transcribed mRNA catabolic process	IBA	biological process
GO:0001147	transcription termination site sequence-specific DNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004534	5'-3' exoribonuclease activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006139	nucleobase-containing compound metabolic process	IEA	biological process
GO:0006353	DNA-templated transcription, termination	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0004527	exonuclease activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0006397	mRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004518	nuclease activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006396	RNA processing	TAS	biological process
GO:0006401	RNA catabolic process	TAS	biological process
GO:0000175	3'-5'-exoribonuclease activity	EXP	molecular function
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030182	neuron differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016070	RNA metabolic process	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0000738	DNA catabolic process, exonucleolytic	IDA	biological process
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0004534	5'-3' exoribonuclease activity	TAS	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0016070	RNA metabolic process	ISS	biological process
GO:0007283	spermatogenesis	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
adenoid cystic carcinoma	PMID:21692051
lung cancer	PMID:19915612
Leiomyosarcoma	PMID:24485798
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)