• Gene id: 22800

Gene Summary

• Gene Symbol: RRAS2   Gene   UCSC   Ensembl
• Aliases: NS12, TC21
• Gene name: RAS related 2
• Alternate names: ras-related protein R-Ras2, ras-like protein TC21, related RAS viral (r-ras) oncogene homolog 2, teratocarcinoma oncogene,
• Gene location: 11p15.2 (14364505: 14277919)     Exons: 9     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the R-Ras subfamily of Ras-like small GTPases. The encoded protein associates with the plasma membrane and may function as a signal transducer. This protein may play an important role in activating signal transduction pathway
• OMIM: 600098

Protein Summary

• Protein general information: P62070  
  • Name: Ras related protein R Ras2 (EC 3.6.5. ) (Ras like protein TC21) (Teratocarcinoma oncogene)
  • Length: 204  
  • Mass: 23400
  • Tissue specificity: Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas. {ECO
• Sequence:

  MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEF
  GAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLK
  VTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • PDB: 2ERY
  • PDBsum: 2ERY
  • STRING: ENSP00000256196
• Other Databases: GeneCards:  RRAS2  Malacards:  RRAS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0007265	Ras protein signal transduction	IBA	biological process
GO:0019003	GDP binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0005886	plasma membrane	NAS	cellular component
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0007265	Ras protein signal transduction	IEA	biological process
GO:0009987	cellular process	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:1901214	regulation of neuron death	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0001649	osteoblast differentiation	HDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04024	cAMP signaling pathway
hsa05205	Proteoglycans in cancer
hsa04072	Phospholipase D signaling pathway
hsa04140	Autophagy - animal
hsa04371	Apelin signaling pathway
hsa04218	Cellular senescence
hsa04625	C-type lectin receptor signaling pathway
hsa04137	Mitophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881