• Gene id: 2268

Gene Summary

• Gene Symbol: FGR   Gene   UCSC   Ensembl
• Aliases: SRC2, c-fgr, c-src2, p55-Fgr, p55c-fgr, p58-Fgr, p58c-fgr
• Gene name: FGR proto-oncogene, Src family tyrosine kinase
• Alternate names: tyrosine-protein kinase Fgr, Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, c-fgr protooncogene, c-src-2 proto-oncogene, feline Gardner-Rasheed sarcoma viral oncogene homolog, p55-c-fgr protein, proto-oncogene c-Fgr, proto-oncogene tyrosine-prote,
• Gene location: 1p35.3 (27635560: 27612063)     Exons: 18     NC_000001.11
• Gene summary(Entrez): This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactio
• OMIM: 602445

Protein Summary

• Protein general information: P09769  
  • Name: Tyrosine protein kinase Fgr (EC 2.7.10.2) (Gardner Rasheed feline sarcoma viral (v fgr) oncogene homolog) (Proto oncogene c Fgr) (p55 Fgr) (p58 Fgr) (p58c Fgr)
  • Length: 529  
  • Mass: 59479
  • Tissue specificity: Detected in neutrophils, monocytes and natural killer cells (at protein level). Detected in monocytes and large lymphocytes. {ECO
• Sequence:

  MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVS
  GIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSSGKTGCIPSNYVAPVDSIQAEEWYFGKIG
  RKDAERQLLSPGNPQGAFLIRESETTKGAYSLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQH
  YMEVNDGLCNLLIAPCTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
  KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLVDMAAQVAEGMAYMER
  MNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKFPIKWTAPEAALFGRFTIKSDVWSFGILLTE
  LITKGRIPYPGMNKREVLEQVEQGYHMPCPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQP
  GDQT

• Structural information:
  • Protein Domains: (77..13-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (144..24-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (263..51-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR035693  IPR011009  IPR000719  IPR017441  IPR001245   IPR000980  IPR036860  IPR036028  IPR001452  IPR008266  IPR020635  
  • Prosite: PS00107 PS50011 PS00109 PS50001 PS50002
  • CDD: cd10367
  • DIP: 1049
  • STRING: ENSP00000363117
• Other Databases: GeneCards:  FGR  Malacards:  FGR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0007229	integrin-mediated signaling pathway	IBA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0034988	Fc-gamma receptor I complex binding	IDA	molecular function
GO:0005856	cytoskeleton	IDA	colocalizes with
GO:0050830	defense response to Gram-positive bacterium	ISS	biological process
GO:0050715	positive regulation of cytokine secretion	ISS	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0043306	positive regulation of mast cell degranulation	ISS	biological process
GO:0032587	ruffle membrane	ISS	colocalizes with
GO:0030335	positive regulation of cell migration	ISS	biological process
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IMP	biological process
GO:0008360	regulation of cell shape	ISS	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	IMP	biological process
GO:0007229	integrin-mediated signaling pathway	ISS	biological process
GO:0002768	immune response-regulating cell surface receptor signaling pathway	TAS	biological process
GO:0050764	regulation of phagocytosis	ISS	biological process
GO:0045859	regulation of protein kinase activity	ISS	biological process
GO:0045088	regulation of innate immune response	ISS	biological process
GO:0034987	immunoglobulin receptor binding	ISS	molecular function
GO:0019901	protein kinase binding	ISS	molecular function
GO:0005886	plasma membrane	ISS	cellular component
GO:0001784	phosphotyrosine residue binding	ISS	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0009615	response to virus	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	TAS	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0032815	negative regulation of natural killer cell activation	IEA	biological process
GO:0043306	positive regulation of mast cell degranulation	IEA	biological process
GO:0048705	skeletal system morphogenesis	IEA	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0050830	defense response to Gram-positive bacterium	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0001784	phosphotyrosine residue binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030282	bone mineralization	IEA	biological process
GO:0034987	immunoglobulin receptor binding	IEA	molecular function
GO:0045088	regulation of innate immune response	IEA	biological process
GO:0045859	regulation of protein kinase activity	IEA	biological process
GO:0050764	regulation of phagocytosis	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005758	mitochondrial intermembrane space	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0032587	ruffle membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0001784	phosphotyrosine residue binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04062	Chemokine signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R