• Gene id: 2263

Gene Summary

• Gene Symbol: FGFR2   Gene   UCSC   Ensembl
• Aliases: BBDS, BEK, BFR-1, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
• Gene name: fibroblast growth factor receptor 2
• Alternate names: fibroblast growth factor receptor 2, BEK fibroblast growth factor receptor, bacteria-expressed kinase, keratinocyte growth factor receptor, protein tyrosine kinase, receptor like 14,
• Gene location: 10q26.13 (121598457: 121478329)     Exons: 24     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities an
• OMIM: 176943

Protein Summary

• Protein general information: P21802  
  • Name: Fibroblast growth factor receptor 2 (FGFR 2) (EC 2.7.10.1) (K sam) (KGFR) (Keratinocyte growth factor receptor) (CD antigen CD332)
  • Length: 821  
  • Mass: 92,025
• Sequence:

  MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKD
  GVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYFMVNVTDAISSGDDEDDTDGAEDFVSENSNN
  KRAPYWTNTEKMEKRLHAVPAANTVKFRCPAGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSD
  KGNYTCVVENEYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
  YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVLPAPGREKEITASPDY
  LEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTKRIPLRRQVTVSAESSSSMNSNTPLVRITTR
  LSSTADTPMLAGVSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATE
  KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
  KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKTTNGRLPVKWMAPEAL
  FDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTF
  KQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT

• Structural information:
  • Protein Domains: Ig-like (25-125)
    Ig-like (154-247)
    Ig-like (256-358)
    Protein (481-770)
  • Interpro: IPR016248  IPR007110  IPR036179  IPR013783  IPR013098   IPR003599  IPR003598  IPR011009  IPR000719  IPR017441  IPR001245  IPR008266  IPR020635  
  • Prosite: PS50835 PS00107 PS50011 PS00109
  • PDB: 1DJS 1E0O 1EV2 1GJO 1II4 1IIL 1NUN 1OEC 1WVZ 2FDB 2PSQ 2PVF 2PVY 2PWL 2PY3 2PZ5 2PZP 2PZR 2Q0B 3B2T 3CAF 3CLY 3CU1 3DAR 3EUU 3OJ2 3OJM 3RI1 4J23 4J95 4J96 4J97 4J98 4J99 4WV1 5EG3 5UGL 5UGX 5UHN 5UI0
  • PDBsum: 1DJS 1E0O 1EV2 1GJO 1II4 1IIL 1NUN 1OEC 1WVZ 2FDB 2PSQ 2PVF 2PVY 2PWL 2PY3 2PZ5 2PZP 2PZR 2Q0B 3B2T 3CAF 3CLY 3CU1 3DAR 3EUU 3OJ2 3OJM 3RI1 4J23 4J95 4J96 4J97 4J98 4J99 4WV1 5EG3 5UGL 5UGX 5UHN 5UI0
  • DIP: 3788
  • STRING: ENSP00000410294
• Other Databases: GeneCards:  FGFR2  Malacards:  FGFR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001701	in utero embryonic development	ISS	biological process
GO:0001837	epithelial to mesenchymal transition	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0003149	membranous septum morphogenesis	ISS	biological process
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IGI	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0007267	cell-cell signaling	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008589	regulation of smoothened signaling pathway	ISS	biological process
GO:0009791	post-embryonic development	ISS	biological process
GO:0009880	embryonic pattern specification	ISS	biological process
GO:0009887	animal organ morphogenesis	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010453	regulation of cell fate commitment	ISS	biological process
GO:0010518	positive regulation of phospholipase activity	IMP	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0016020	membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0016331	morphogenesis of embryonic epithelium	ISS	biological process
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0021769	orbitofrontal cortex development	ISS	biological process
GO:0021847	ventricular zone neuroblast division	ISS	biological process
GO:0021860	pyramidal neuron development	ISS	biological process
GO:0022612	gland morphogenesis	ISS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0030324	lung development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0030901	midbrain development	ISS	biological process
GO:0030916	otic vesicle formation	ISS	biological process
GO:0031069	hair follicle morphogenesis	ISS	biological process
GO:0032808	lacrimal gland development	ISS	biological process
GO:0033688	regulation of osteoblast proliferation	TAS	biological process
GO:0035264	multicellular organism growth	ISS	biological process
GO:0035265	organ growth	ISS	biological process
GO:0035602	fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow	ISS	biological process
GO:0035603	fibroblast growth factor receptor signaling pathway involved in hemopoiesis	ISS	biological process
GO:0035604	fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow	ISS	biological process
GO:0035607	fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development	ISS	biological process
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IEA	biological process
GO:0040014	regulation of multicellular organism growth	ISS	biological process
GO:0040036	regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0042472	inner ear morphogenesis	ISS	biological process
GO:0042476	odontogenesis	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045667	regulation of osteoblast differentiation	TAS	biological process
GO:0045787	positive regulation of cell cycle	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048286	lung alveolus development	ISS	biological process
GO:0048333	mesodermal cell differentiation	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological process
GO:0048562	embryonic organ morphogenesis	ISS	biological process
GO:0048565	digestive tract development	ISS	biological process
GO:0048568	embryonic organ development	ISS	biological process
GO:0048608	reproductive structure development	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048705	skeletal system morphogenesis	TAS	biological process
GO:0048730	epidermis morphogenesis	ISS	biological process
GO:0048755	branching morphogenesis of a nerve	ISS	biological process
GO:0048762	mesenchymal cell differentiation	ISS	biological process
GO:0050679	positive regulation of epithelial cell proliferation	ISS	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0051150	regulation of smooth muscle cell differentiation	ISS	biological process
GO:0051781	positive regulation of cell division	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	ISS	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060174	limb bud formation	ISS	biological process
GO:0060348	bone development	ISS	biological process
GO:0060349	bone morphogenesis	ISS	biological process
GO:0060442	branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060445	branching involved in salivary gland morphogenesis	ISS	biological process
GO:0060449	bud elongation involved in lung branching	ISS	biological process
GO:0060463	lung lobe morphogenesis	ISS	biological process
GO:0060484	lung-associated mesenchyme development	ISS	biological process
GO:0060501	positive regulation of epithelial cell proliferation involved in lung morphogenesis	ISS	biological process
GO:0060512	prostate gland morphogenesis	ISS	biological process
GO:0060523	prostate epithelial cord elongation	ISS	biological process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	ISS	biological process
GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	ISS	biological process
GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification	ISS	biological process
GO:0060601	lateral sprouting from an epithelium	ISS	biological process
GO:0060615	mammary gland bud formation	ISS	biological process
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	ISS	biological process
GO:0060667	branch elongation involved in salivary gland morphogenesis	ISS	biological process
GO:0060670	branching involved in labyrinthine layer morphogenesis	ISS	biological process
GO:0060687	regulation of branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060688	regulation of morphogenesis of a branching structure	ISS	biological process
GO:0060915	mesenchymal cell differentiation involved in lung development	ISS	biological process
GO:0060916	mesenchymal cell proliferation involved in lung development	ISS	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001525	angiogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001701	in utero embryonic development	ISS	biological process
GO:0001837	epithelial to mesenchymal transition	IEA	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0003149	membranous septum morphogenesis	ISS	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004714	transmembrane receptor protein tyrosine kinase activity	IEA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IEA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IEA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IGI	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0007267	cell-cell signaling	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0008284	positive regulation of cell proliferation	IEA	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008589	regulation of smoothened signaling pathway	ISS	biological process
GO:0009791	post-embryonic development	ISS	biological process
GO:0009880	embryonic pattern specification	ISS	biological process
GO:0009887	animal organ morphogenesis	ISS	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0010453	regulation of cell fate commitment	ISS	biological process
GO:0010518	positive regulation of phospholipase activity	IMP	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	NAS	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016331	morphogenesis of embryonic epithelium	ISS	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0017134	fibroblast growth factor binding	IEA	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0021769	orbitofrontal cortex development	ISS	biological process
GO:0021847	ventricular zone neuroblast division	ISS	biological process
GO:0021860	pyramidal neuron development	ISS	biological process
GO:0022612	gland morphogenesis	ISS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0030324	lung development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0030901	midbrain development	ISS	biological process
GO:0030916	otic vesicle formation	ISS	biological process
GO:0031069	hair follicle morphogenesis	ISS	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0032808	lacrimal gland development	ISS	biological process
GO:0033688	regulation of osteoblast proliferation	TAS	biological process
GO:0035264	multicellular organism growth	ISS	biological process
GO:0035265	organ growth	ISS	biological process
GO:0035602	fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow	ISS	biological process
GO:0035603	fibroblast growth factor receptor signaling pathway involved in hemopoiesis	ISS	biological process
GO:0035604	fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow	ISS	biological process
GO:0035607	fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development	ISS	biological process
GO:0036092	phosphatidylinositol-3-phosphate biosynthetic process	IEA	biological process
GO:0040014	regulation of multicellular organism growth	ISS	biological process
GO:0040036	regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0042472	inner ear morphogenesis	ISS	biological process
GO:0042476	odontogenesis	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0043547	positive regulation of GTPase activity	IEA	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045667	regulation of osteoblast differentiation	TAS	biological process
GO:0045787	positive regulation of cell cycle	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048286	lung alveolus development	ISS	biological process
GO:0048333	mesodermal cell differentiation	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological process
GO:0048562	embryonic organ morphogenesis	ISS	biological process
GO:0048565	digestive tract development	ISS	biological process
GO:0048568	embryonic organ development	ISS	biological process
GO:0048608	reproductive structure development	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048705	skeletal system morphogenesis	TAS	biological process
GO:0048730	epidermis morphogenesis	ISS	biological process
GO:0048755	branching morphogenesis of a nerve	ISS	biological process
GO:0048762	mesenchymal cell differentiation	ISS	biological process
GO:0050679	positive regulation of epithelial cell proliferation	ISS	biological process
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0051150	regulation of smooth muscle cell differentiation	ISS	biological process
GO:0051781	positive regulation of cell division	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	ISS	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060174	limb bud formation	ISS	biological process
GO:0060348	bone development	ISS	biological process
GO:0060349	bone morphogenesis	ISS	biological process
GO:0060442	branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060445	branching involved in salivary gland morphogenesis	ISS	biological process
GO:0060449	bud elongation involved in lung branching	ISS	biological process
GO:0060463	lung lobe morphogenesis	ISS	biological process
GO:0060484	lung-associated mesenchyme development	ISS	biological process
GO:0060501	positive regulation of epithelial cell proliferation involved in lung morphogenesis	ISS	biological process
GO:0060512	prostate gland morphogenesis	ISS	biological process
GO:0060523	prostate epithelial cord elongation	ISS	biological process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	ISS	biological process
GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	ISS	biological process
GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification	ISS	biological process
GO:0060601	lateral sprouting from an epithelium	ISS	biological process
GO:0060615	mammary gland bud formation	ISS	biological process
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	ISS	biological process
GO:0060667	branch elongation involved in salivary gland morphogenesis	ISS	biological process
GO:0060670	branching involved in labyrinthine layer morphogenesis	ISS	biological process
GO:0060687	regulation of branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060688	regulation of morphogenesis of a branching structure	ISS	biological process
GO:0060915	mesenchymal cell differentiation involved in lung development	ISS	biological process
GO:0060916	mesenchymal cell proliferation involved in lung development	ISS	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0031012	extracellular matrix	IDA	cellular component
GO:0000122	negative regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0001525	angiogenesis	ISS	biological process
GO:0001657	ureteric bud development	ISS	biological process
GO:0001701	in utero embryonic development	ISS	biological process
GO:0002053	positive regulation of mesenchymal cell proliferation	ISS	biological process
GO:0003148	outflow tract septum morphogenesis	ISS	biological process
GO:0003149	membranous septum morphogenesis	ISS	biological process
GO:0004713	protein tyrosine kinase activity	NAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IGI	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	IDA	molecular function
GO:0005007	fibroblast growth factor-activated receptor activity	NAS	molecular function
GO:0005088	Ras guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0007267	cell-cell signaling	ISS	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0008284	positive regulation of cell proliferation	IMP	biological process
GO:0008284	positive regulation of cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008589	regulation of smoothened signaling pathway	ISS	biological process
GO:0009791	post-embryonic development	ISS	biological process
GO:0009880	embryonic pattern specification	ISS	biological process
GO:0009887	animal organ morphogenesis	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010453	regulation of cell fate commitment	ISS	biological process
GO:0010518	positive regulation of phospholipase activity	IMP	biological process
GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	TAS	biological process
GO:0016020	membrane	NAS	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0016303	1-phosphatidylinositol-3-kinase activity	TAS	molecular function
GO:0016331	morphogenesis of embryonic epithelium	ISS	biological process
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IPI	molecular function
GO:0017134	fibroblast growth factor binding	IDA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0021769	orbitofrontal cortex development	ISS	biological process
GO:0021847	ventricular zone neuroblast division	ISS	biological process
GO:0021860	pyramidal neuron development	ISS	biological process
GO:0022612	gland morphogenesis	ISS	biological process
GO:0030177	positive regulation of Wnt signaling pathway	ISS	biological process
GO:0030282	bone mineralization	ISS	biological process
GO:0030324	lung development	ISS	biological process
GO:0030855	epithelial cell differentiation	ISS	biological process
GO:0030901	midbrain development	ISS	biological process
GO:0030916	otic vesicle formation	ISS	biological process
GO:0031069	hair follicle morphogenesis	ISS	biological process
GO:0032808	lacrimal gland development	ISS	biological process
GO:0033688	regulation of osteoblast proliferation	TAS	biological process
GO:0035264	multicellular organism growth	ISS	biological process
GO:0035265	organ growth	ISS	biological process
GO:0035602	fibroblast growth factor receptor signaling pathway involved in negative regulation of apoptotic process in bone marrow	ISS	biological process
GO:0035603	fibroblast growth factor receptor signaling pathway involved in hemopoiesis	ISS	biological process
GO:0035604	fibroblast growth factor receptor signaling pathway involved in positive regulation of cell proliferation in bone marrow	ISS	biological process
GO:0035607	fibroblast growth factor receptor signaling pathway involved in orbitofrontal cortex development	ISS	biological process
GO:0040014	regulation of multicellular organism growth	ISS	biological process
GO:0040036	regulation of fibroblast growth factor receptor signaling pathway	ISS	biological process
GO:0042472	inner ear morphogenesis	ISS	biological process
GO:0042476	odontogenesis	ISS	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0043410	positive regulation of MAPK cascade	IMP	biological process
GO:0045165	cell fate commitment	ISS	biological process
GO:0045667	regulation of osteoblast differentiation	TAS	biological process
GO:0045787	positive regulation of cell cycle	ISS	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	ISS	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	TAS	molecular function
GO:0048015	phosphatidylinositol-mediated signaling	TAS	biological process
GO:0048286	lung alveolus development	ISS	biological process
GO:0048557	embryonic digestive tract morphogenesis	ISS	biological process
GO:0048562	embryonic organ morphogenesis	ISS	biological process
GO:0048565	digestive tract development	ISS	biological process
GO:0048568	embryonic organ development	ISS	biological process
GO:0048608	reproductive structure development	ISS	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IMP	biological process
GO:0048705	skeletal system morphogenesis	TAS	biological process
GO:0048730	epidermis morphogenesis	ISS	biological process
GO:0048755	branching morphogenesis of a nerve	ISS	biological process
GO:0048762	mesenchymal cell differentiation	ISS	biological process
GO:0050679	positive regulation of epithelial cell proliferation	ISS	biological process
GO:0051150	regulation of smooth muscle cell differentiation	ISS	biological process
GO:0051781	positive regulation of cell division	ISS	biological process
GO:0055010	ventricular cardiac muscle tissue morphogenesis	ISS	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	ISS	biological process
GO:0060076	excitatory synapse	ISS	cellular component
GO:0060174	limb bud formation	ISS	biological process
GO:0060348	bone development	ISS	biological process
GO:0060349	bone morphogenesis	ISS	biological process
GO:0060442	branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060445	branching involved in salivary gland morphogenesis	ISS	biological process
GO:0060449	bud elongation involved in lung branching	ISS	biological process
GO:0060463	lung lobe morphogenesis	ISS	biological process
GO:0060484	lung-associated mesenchyme development	ISS	biological process
GO:0060501	positive regulation of epithelial cell proliferation involved in lung morphogenesis	ISS	biological process
GO:0060512	prostate gland morphogenesis	ISS	biological process
GO:0060523	prostate epithelial cord elongation	ISS	biological process
GO:0060527	prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis	ISS	biological process
GO:0060529	squamous basal epithelial stem cell differentiation involved in prostate gland acinus development	ISS	biological process
GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification	ISS	biological process
GO:0060601	lateral sprouting from an epithelium	ISS	biological process
GO:0060615	mammary gland bud formation	ISS	biological process
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	ISS	biological process
GO:0060667	branch elongation involved in salivary gland morphogenesis	ISS	biological process
GO:0060670	branching involved in labyrinthine layer morphogenesis	ISS	biological process
GO:0060687	regulation of branching involved in prostate gland morphogenesis	ISS	biological process
GO:0060688	regulation of morphogenesis of a branching structure	ISS	biological process
GO:0060915	mesenchymal cell differentiation involved in lung development	ISS	biological process
GO:0060916	mesenchymal cell proliferation involved in lung development	ISS	biological process
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0031012	extracellular matrix	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04144	Endocytosis
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04810	Regulation of actin cytoskeleton
hsa05200	Pathways in cancer
hsa05230	Central carbon metabolism in cancer
hsa05226	Gastric cancer
hsa05215	Prostate cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer (ovarian)	GAD: 18973230
Cancer (pancreatic)	GAD: 19351817
Cancer	GAD: 17529967
Cancer (basal cell)	GAD: 19500394
Cancer (Squamous cell)	GAD: 19812598
Cancer (gastric)	GAD: H00018
Cancer (breast)	GAD: 17529967
Hypertension	GAD: 20717167
Cleft defects	GAD: 19937600
Craniosynostosis	GAD: 11781872
Bronchial hyperreactivity	GAD: 18315732
Antley-Bixler syndrome	KEGG: H01753
Bone diseases	GAD: 19453261
Alzheimer's disease	GAD: 19141999
Schizophrenia	GAD: 18813210
Endometriosis	GAD: 18285324
Female infertility	INFBASE: 18285324
Disorders of sexual development (DSD)	MIK: 21048976
Male factor infertility	MIK: 21048976
Hypospadias	GAD: 17264867
Oral clefts	GAD: 19937600
Apert syndrome	KEGG: H01755
Lacrimo-auriculo-dento-digital syndrome	KEGG: H00642
Pfeiffer syndrome	KEGG: H01756
Crouzon syndrome	KEGG: H01754
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Disorders of sexual development (DSD)	MIK: 21048976

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21048976	Disorders of sexual development (DSD)			9067 (116 with idiopathic DSD, 8951 controls)	Male infertility	SRY DMRT1 FGFR2 KANK1 ADCY2 and ZEB2
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq