• Gene id: 226

Gene Summary

• Gene Symbol: ALDOA   Gene   UCSC   Ensembl
• Aliases: ALDA, GSD12, HEL-S-87p
• Gene name: aldolase, fructose-bisphosphate A
• Alternate names: fructose-bisphosphate aldolase A, aldolase A, fructose-bisphosphate, epididymis secretory sperm binding protein Li 87p, fructose-1,6-bisphosphate triosephosphate-lyase, lung cancer antigen NY-LU-1, muscle-type aldolase,
• Gene location: 16p11.2 (30064278: 30070419)     Exons: 11     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone ph
• OMIM: 103850

Protein Summary

• Protein general information: P04075  
  • Name: Fructose bisphosphate aldolase A (EC 4.1.2.13) (Lung cancer antigen NY LU 1) (Muscle type aldolase)
  • Length: 364  
  • Mass: 39420
• Sequence:

  MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIG
  GVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGLSERCAQYKKDGADFAKWRC
  VLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLE
  GTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
  SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAY

• Structural information:
  • Interpro: IPR029768  IPR013785  IPR000741  
  • Prosite: PS00158
  • PDB: 1ALD 2ALD 4ALD 5KY6
  • PDBsum: 1ALD 2ALD 4ALD 5KY6
  • STRING: ENSP00000378669
• Other Databases: GeneCards:  ALDOA  Malacards:  ALDOA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004332	fructose-bisphosphate aldolase activity	IBA	molecular function
GO:0006096	glycolytic process	IBA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0051289	protein homotetramerization	ISS	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0006096	glycolytic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0004332	fructose-bisphosphate aldolase activity	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0061621	canonical glycolysis	TAS	biological process
GO:1904724	tertiary granule lumen	TAS	cellular component
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008092	cytoskeletal protein binding	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0004332	fructose-bisphosphate aldolase activity	IDA	molecular function
GO:0070061	fructose binding	IDA	molecular function
GO:0003779	actin binding	TAS	molecular function
GO:0015631	tubulin binding	TAS	molecular function
GO:0070061	fructose binding	IDA	molecular function
GO:0042802	identical protein binding	TAS	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0008360	regulation of cell shape	IDA	biological process
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0006000	fructose metabolic process	IMP	biological process
GO:0006754	ATP biosynthetic process	IMP	biological process
GO:0007015	actin filament organization	TAS	biological process
GO:0031674	I band	TAS	cellular component
GO:0046716	muscle cell cellular homeostasis	IMP	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0030388	fructose 1,6-bisphosphate metabolic process	IDA	biological process
GO:0006096	glycolytic process	IMP	biological process
GO:0006941	striated muscle contraction	IMP	biological process
GO:0031674	I band	IEA	cellular component
GO:0031430	M band	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006096	glycolytic process	IEA	biological process
GO:0007339	binding of sperm to zona pellucida	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0061827	sperm head	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005615	extracellular space	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa04066	HIF-1 signaling pathway
hsa01230	Biosynthesis of amino acids
hsa00010	Glycolysis / Gluconeogenesis
hsa00051	Fructose and mannose metabolism
hsa00030	Pentose phosphate pathway

Diseases

Associated diseases	References
Glycogen storage disease	KEGG:H00069
Muscle glycogen storage disease	KEGG:H01762
Glycogen storage disease type XII	KEGG:H01952
Glycogen storage disease	KEGG:H00069
Muscle glycogen storage disease	KEGG:H01762
Glycogen storage disease type XII	KEGG:H01952
Cystadenoma	PMID:19077459
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray