• Gene id: 225689

Gene Summary

• Gene Symbol: MAPK15   Gene   UCSC   Ensembl
• Aliases: ERK7, ERK8
• Gene name: mitogen-activated protein kinase 15
• Alternate names: mitogen-activated protein kinase 15, ERK-7, ERK-8, MAP kinase 15, MAPK 15, extracellular regulated kinase 8 delta, extracellular signal-regulated kinase 7, extracellular signal-regulated kinase 8,
• Gene location: 8q24.3 (143716304: 143722457)     Exons: 14     NC_000008.11

Protein Summary

• Protein general information: Q8TD08  
  • Name: Mitogen activated protein kinase 15 (MAP kinase 15) (MAPK 15) (EC 2.7.11.24) (Extracellular signal regulated kinase 7) (ERK 7) (Extracellular signal regulated kinase 8) (ERK 8)
  • Length: 544  
  • Mass: 59832
  • Tissue specificity: Widely expressed with a maximal expression in lung and kidney. {ECO
• Sequence:

  MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIIS
  LLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCT
  VKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLH
  QLELILETIPPPSEEDLLALGSGCRASVLHQLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
  HPYVQRFHCPSDEWAREADVRPRAHEGVQLSVPEYRSRVYQMILECGGSSGTSREKGPEGVSPSQAHLHKPRADP
  QLPSRTPVQGPRPRPQSSPGHDPAEHESPRAAKNVPRQNSAPLLQTALLGNGERPPGAKEAPPLTLSLVKPSGRG
  AAPSLTSQAAAQVANQALIRGDWNRGGGVRVASVQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAY
  GTVCHSALGHLPLLEGHHV

• Structural information:
  • Protein Domains: (13..30-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR003527  IPR000719  IPR017441  
  • Prosite: PS01351 PS00107 PS50011
  • STRING: ENSP00000337691
• Other Databases: GeneCards:  MAPK15  Malacards:  MAPK15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010468	regulation of gene expression	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0004707	MAP kinase activity	IBA	molecular function
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005930	axoneme	IDA	NOT|cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0010506	regulation of autophagy	IDA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0090494	dopamine uptake	IDA	biological process
GO:0005814	centriole	IDA	cellular component
GO:0005776	autophagosome	IDA	cellular component
GO:0004672	protein kinase activity	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0003400	regulation of COPII vesicle coating	IMP	biological process
GO:1902017	regulation of cilium assembly	IMP	biological process
GO:1902017	regulation of cilium assembly	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1904491	protein localization to ciliary transition zone	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007029	endoplasmic reticulum organization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004707	MAP kinase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1905832	positive regulation of spindle assembly	IEA	biological process
GO:1905188	positive regulation of metaphase/anaphase transition of meiosis I	IEA	biological process
GO:0072687	meiotic spindle	IEA	cellular component
GO:1902017	regulation of cilium assembly	IEA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IDA	biological process
GO:1904355	positive regulation of telomere capping	IDA	biological process
GO:0051973	positive regulation of telomerase activity	IDA	biological process
GO:0032212	positive regulation of telomere maintenance via telomerase	IMP	biological process
GO:1904355	positive regulation of telomere capping	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IMP	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005814	centriole	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0000165	MAPK cascade	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0004707	MAP kinase activity	IDA	molecular function
GO:0017124	SH3 domain binding	NAS	molecular function
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Breast cancer	PMID:12917323
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq