• Gene id: 2255

Gene Summary

• Gene Symbol: FGF10   Gene   UCSC   Ensembl
• Gene name: fibroblast growth factor 10
• Alternate names: fibroblast growth factor 10, FGF-10, keratinocyte growth factor 2, produced by fibroblasts of urinary bladder lamina propria,
• Gene location: 5p12 (44389705: 44300246)     Exons: 3     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel
• OMIM: 300655

Protein Summary

• Protein general information: O15520  
  • Name: Fibroblast growth factor 10 (FGF 10) (Keratinocyte growth factor 2)
  • Length: 208  
  • Mass: 23436
• Sequence:

  MWKWILTHCASAFPHLPGCCCCCFLLLFLVSSVPVTCQALGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQG
  DVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDC
  KLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

• Structural information:
  • Interpro: IPR028252  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • PDB: 1NUN
  • PDBsum: 1NUN
  • DIP: 6037
  • STRING: ENSP00000264664
• Other Databases: GeneCards:  FGF10  Malacards:  FGF10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0050677	positive regulation of urothelial cell proliferation	IDA	biological process
GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification	IDA	biological process
GO:0060447	bud outgrowth involved in lung branching	IDA	biological process
GO:0060428	lung epithelium development	IDA	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0000165	MAPK cascade	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070384	Harderian gland development	IEA	biological process
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA	biological process
GO:0060594	mammary gland specification	IEA	biological process
GO:0060541	respiratory system development	IEA	biological process
GO:0060510	type II pneumocyte differentiation	IEA	biological process
GO:0060496	mesenchymal-epithelial cell signaling involved in lung development	IEA	biological process
GO:0060449	bud elongation involved in lung branching	IEA	biological process
GO:0060445	branching involved in salivary gland morphogenesis	IEA	biological process
GO:0060436	bronchiole morphogenesis	IEA	biological process
GO:0060174	limb bud formation	IEA	biological process
GO:0060019	radial glial cell differentiation	IEA	biological process
GO:0050872	white fat cell differentiation	IEA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0048807	female genitalia morphogenesis	IEA	biological process
GO:0048730	epidermis morphogenesis	IEA	biological process
GO:0048645	animal organ formation	IEA	biological process
GO:0048514	blood vessel morphogenesis	IEA	biological process
GO:0045931	positive regulation of mitotic cell cycle	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045747	positive regulation of Notch signaling pathway	IEA	biological process
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0042693	muscle cell fate commitment	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0032925	regulation of activin receptor signaling pathway	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0030949	positive regulation of vascular endothelial growth factor receptor signaling pathway	IEA	biological process
GO:0030878	thyroid gland development	IEA	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IEA	biological process
GO:0021983	pituitary gland development	IEA	biological process
GO:0010634	positive regulation of epithelial cell migration	IEA	biological process
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0008544	epidermis development	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0007267	cell-cell signaling	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0000132	establishment of mitotic spindle orientation	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:2001240	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070352	positive regulation of white fat cell proliferation	IEA	biological process
GO:0061115	lung proximal/distal axis specification	IEA	biological process
GO:0060915	mesenchymal cell differentiation involved in lung development	IEA	biological process
GO:0060879	semicircular canal fusion	IEA	biological process
GO:0060667	branch elongation involved in salivary gland morphogenesis	IEA	biological process
GO:0060664	epithelial cell proliferation involved in salivary gland morphogenesis	IEA	biological process
GO:0060661	submandibular salivary gland formation	IEA	biological process
GO:0060615	mammary gland bud formation	IEA	biological process
GO:0060595	fibroblast growth factor receptor signaling pathway involved in mammary gland specification	IEA	biological process
GO:0060513	prostatic bud formation	IEA	biological process
GO:0060441	epithelial tube branching involved in lung morphogenesis	IEA	biological process
GO:0060425	lung morphogenesis	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0051145	smooth muscle cell differentiation	IEA	biological process
GO:0050930	induction of positive chemotaxis	IEA	biological process
GO:0050918	positive chemotaxis	IEA	biological process
GO:0048808	male genitalia morphogenesis	IEA	biological process
GO:0048752	semicircular canal morphogenesis	IEA	biological process
GO:0048566	embryonic digestive tract development	IEA	biological process
GO:0048565	digestive tract development	IEA	biological process
GO:0048557	embryonic digestive tract morphogenesis	IEA	biological process
GO:0048536	spleen development	IEA	biological process
GO:0048286	lung alveolus development	IEA	biological process
GO:0048146	positive regulation of fibroblast proliferation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042056	chemoattractant activity	IEA	molecular function
GO:0035265	organ growth	IEA	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0032808	lacrimal gland development	IEA	biological process
GO:0031076	embryonic camera-type eye development	IEA	biological process
GO:0031016	pancreas development	IEA	biological process
GO:0030916	otic vesicle formation	IEA	biological process
GO:0030855	epithelial cell differentiation	IEA	biological process
GO:0030538	embryonic genitalia morphogenesis	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0010838	positive regulation of keratinocyte proliferation	IEA	biological process
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009880	embryonic pattern specification	IEA	biological process
GO:0008589	regulation of smoothened signaling pathway	IEA	biological process
GO:0007435	salivary gland morphogenesis	IEA	biological process
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0003338	metanephros morphogenesis	IEA	biological process
GO:0001759	organ induction	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0001759	organ induction	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0071157	negative regulation of cell cycle arrest	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IDA	biological process
GO:0048538	thymus development	IDA	biological process
GO:0042060	wound healing	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0000187	activation of MAPK activity	IDA	biological process
GO:0051549	positive regulation of keratinocyte migration	IDA	biological process
GO:0050673	epithelial cell proliferation	IDA	biological process
GO:0046579	positive regulation of Ras protein signal transduction	IDA	biological process
GO:0034394	protein localization to cell surface	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0008083	growth factor activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IDA	molecular function
GO:0071338	positive regulation of hair follicle cell proliferation	IDA	biological process
GO:0070371	ERK1 and ERK2 cascade	IDA	biological process
GO:0061033	secretion by lung epithelial cell involved in lung growth	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0050677	positive regulation of urothelial cell proliferation	IDA	biological process
GO:0050674	urothelial cell proliferation	IDA	biological process
GO:0042060	wound healing	IDA	biological process
GO:1900087	positive regulation of G1/S transition of mitotic cell cycle	IDA	biological process
GO:0062023	collagen-containing extracellular matrix	IDA	colocalizes with
GO:0010634	positive regulation of epithelial cell migration	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051549	positive regulation of keratinocyte migration	IDA	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0050671	positive regulation of lymphocyte proliferation	IDA	biological process
GO:0045739	positive regulation of DNA repair	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0032781	positive regulation of ATPase activity	IDA	biological process
GO:0010838	positive regulation of keratinocyte proliferation	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070075	tear secretion	IMP	biological process
GO:0032808	lacrimal gland development	IMP	biological process
GO:0009986	cell surface	NAS	cellular component
GO:0005111	type 2 fibroblast growth factor receptor binding	IPI	molecular function
GO:0060019	radial glial cell differentiation	ISS	biological process
GO:0046877	regulation of saliva secretion	IMP	biological process
GO:0007431	salivary gland development	IMP	biological process
GO:0060430	lung saccule development	IMP	biological process
GO:0060054	positive regulation of epithelial cell proliferation involved in wound healing	NAS	biological process
GO:0001823	mesonephros development	IEP	biological process
GO:0001656	metanephros development	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa05218	Melanoma

Diseases

Associated diseases	References
Lacrimo-auriculo-dento-digital syndrome	KEGG:H00642
Aplasia of lacrimal and salivary glands	KEGG:H00677
Lacrimo-auriculo-dento-digital syndrome	KEGG:H00642
Aplasia of lacrimal and salivary glands	KEGG:H00677
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R