About Us

Search Result


Gene id 2253
Gene Summary    Protein Summary    Gene ontology    KEGG pathways    Diseases    PubMed    

Gene Summary

Gene Symbol FGF8   Gene   UCSC   Ensembl
Aliases AIGF, FGF-8, HBGF-8, HH6, KAL6
Gene name fibroblast growth factor 8
Alternate names fibroblast growth factor 8, androgen-induced growth factor, fibroblast growth factor 8 (androgen-induced), heparin-binding growth factor 8,
Gene location 10q24.32 (101780368: 101770129)     Exons: 7     NC_000010.11
Gene summary(Entrez) The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel
OMIM 600483

Protein Summary

Protein general information P55075  

Name: Fibroblast growth factor 8 (FGF 8) (Androgen induced growth factor) (AIGF) (Heparin binding growth factor 8) (HBGF 8)

Length: 233  Mass: 26,525

Sequence MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLY
SRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEI
VLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQ
RTWAPEPR
Structural information
Interpro:  IPR028249  IPR002209  IPR008996  
Prosite:   PS00247
CDD:   cd00058

PDB:  
2FDB
PDBsum:   2FDB

DIP:  

59630

STRING:   ENSP00000321797
Other Databases GeneCards:  FGF8  Malacards:  FGF8

Gene ontology

Expand All | Collapse All

GO accessionTerm nameEvidence codeGo category
GO:0000165 MAPK cascade
TAS biological process
GO:0001569 branching involved in blo
od vessel morphogenesis
IEA biological process
GO:0001656 metanephros development
IEP biological process
GO:0001658 branching involved in ure
teric bud morphogenesis
IEA biological process
GO:0001759 organ induction
IEA biological process
GO:0001823 mesonephros development
IEP biological process
GO:0001839 neural plate morphogenesi
s
IEA biological process
GO:0001947 heart looping
IEA biological process
GO:0001974 blood vessel remodeling
IEA biological process
GO:0003148 outflow tract septum morp
hogenesis
ISS biological process
GO:0003198 epithelial to mesenchymal
transition involved in e
ndocardial cushion format
ion
ISS biological process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005104 fibroblast growth factor
receptor binding
IEA molecular function
GO:0005105 type 1 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005111 type 2 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005622 intracellular
IEA cellular component
GO:0006915 apoptotic process
IEA biological process
GO:0006979 response to oxidative str
ess
IEA biological process
GO:0007369 gastrulation
NAS biological process
GO:0008045 motor neuron axon guidanc
e
IEA biological process
GO:0008078 mesodermal cell migration
IEA biological process
GO:0008083 growth factor activity
IEA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
IEA biological process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological process
GO:0008406 gonad development
IMP biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0009653 anatomical structure morp
hogenesis
NAS biological process
GO:0009897 external side of plasma m
embrane
IEA cellular component
GO:0010628 positive regulation of ge
ne expression
TAS biological process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological process
GO:0014070 response to organic cycli
c compound
IEA biological process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular function
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological process
GO:0021543 pallium development
IEA biological process
GO:0021544 subpallium development
IEA biological process
GO:0021798 forebrain dorsal/ventral
pattern formation
IEA biological process
GO:0021846 cell proliferation in for
ebrain
IEA biological process
GO:0021884 forebrain neuron developm
ent
IEA biological process
GO:0023019 signal transduction invol
ved in regulation of gene
expression
IEA biological process
GO:0030509 BMP signaling pathway
IEA biological process
GO:0030539 male genitalia developmen
t
IEA biological process
GO:0030878 thyroid gland development
IEA biological process
GO:0030916 otic vesicle formation
IEA biological process
GO:0030917 midbrain-hindbrain bounda
ry development
IEA biological process
GO:0033563 dorsal/ventral axon guida
nce
IEA biological process
GO:0035116 embryonic hindlimb morpho
genesis
IEA biological process
GO:0035909 aorta morphogenesis
IEA biological process
GO:0036092 phosphatidylinositol-3-ph
osphate biosynthetic proc
ess
IEA biological process
GO:0042056 chemoattractant activity
IEA molecular function
GO:0042476 odontogenesis
IEP biological process
GO:0042487 regulation of odontogenes
is of dentin-containing t
ooth
IEA biological process
GO:0042493 response to drug
IEA biological process
GO:0043524 negative regulation of ne
uron apoptotic process
IEA biological process
GO:0043547 positive regulation of GT
Pase activity
IEA biological process
GO:0045165 cell fate commitment
IEA biological process
GO:0045840 positive regulation of mi
totic nuclear division
IEA biological process
GO:0046622 positive regulation of or
gan growth
IEA biological process
GO:0046854 phosphatidylinositol phos
phorylation
IEA biological process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological process
GO:0048853 forebrain morphogenesis
IEA biological process
GO:0050918 positive chemotaxis
IEA biological process
GO:0055026 negative regulation of ca
rdiac muscle tissue devel
opment
IMP biological process
GO:0060037 pharyngeal system develop
ment
IEA biological process
GO:0060070 canonical Wnt signaling p
athway
IEA biological process
GO:0060128 corticotropin hormone sec
reting cell differentiati
on
IEA biological process
GO:0060129 thyroid-stimulating hormo
ne-secreting cell differe
ntiation
IEA biological process
GO:0060348 bone development
IMP biological process
GO:0060425 lung morphogenesis
IEA biological process
GO:0060445 branching involved in sal
ivary gland morphogenesis
IEA biological process
GO:0060563 neuroepithelial cell diff
erentiation
IDA biological process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
IDA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
TAS biological process
GO:0090134 cell migration involved i
n mesendoderm migration
IEA biological process
GO:0000165 MAPK cascade
IEA biological process
GO:0000165 MAPK cascade
TAS biological process
GO:0001569 branching involved in blo
od vessel morphogenesis
IEA biological process
GO:0001656 metanephros development
IEP biological process
GO:0001658 branching involved in ure
teric bud morphogenesis
IEA biological process
GO:0001759 organ induction
IEA biological process
GO:0001822 kidney development
IEA biological process
GO:0001823 mesonephros development
IEP biological process
GO:0001839 neural plate morphogenesi
s
IEA biological process
GO:0001947 heart looping
IEA biological process
GO:0001974 blood vessel remodeling
IEA biological process
GO:0003007 heart morphogenesis
IEA biological process
GO:0003148 outflow tract septum morp
hogenesis
IEA biological process
GO:0003148 outflow tract septum morp
hogenesis
ISS biological process
GO:0003151 outflow tract morphogenes
is
IEA biological process
GO:0003198 epithelial to mesenchymal
transition involved in e
ndocardial cushion format
ion
IEA biological process
GO:0003198 epithelial to mesenchymal
transition involved in e
ndocardial cushion format
ion
ISS biological process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005102 receptor binding
IEA molecular function
GO:0005104 fibroblast growth factor
receptor binding
IEA molecular function
GO:0005105 type 1 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005111 type 2 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
IEA cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005622 intracellular
IEA cellular component
GO:0006915 apoptotic process
IEA biological process
GO:0006979 response to oxidative str
ess
IEA biological process
GO:0007275 multicellular organism de
velopment
IEA biological process
GO:0007368 determination of left/rig
ht symmetry
IEA biological process
GO:0007369 gastrulation
NAS biological process
GO:0007507 heart development
IEA biological process
GO:0008045 motor neuron axon guidanc
e
IEA biological process
GO:0008078 mesodermal cell migration
IEA biological process
GO:0008083 growth factor activity
IEA molecular function
GO:0008083 growth factor activity
IEA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
IEA biological process
GO:0008284 positive regulation of ce
ll proliferation
IDA biological process
GO:0008406 gonad development
IMP biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IEA biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IEA biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0009653 anatomical structure morp
hogenesis
NAS biological process
GO:0009792 embryo development ending
in birth or egg hatching
IEA biological process
GO:0009897 external side of plasma m
embrane
IEA cellular component
GO:0010628 positive regulation of ge
ne expression
IEA biological process
GO:0010628 positive regulation of ge
ne expression
TAS biological process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological process
GO:0014070 response to organic cycli
c compound
IEA biological process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular function
GO:0018108 peptidyl-tyrosine phospho
rylation
IEA biological process
GO:0021537 telencephalon development
IEA biological process
GO:0021543 pallium development
IEA biological process
GO:0021544 subpallium development
IEA biological process
GO:0021798 forebrain dorsal/ventral
pattern formation
IEA biological process
GO:0021846 cell proliferation in for
ebrain
IEA biological process
GO:0021884 forebrain neuron developm
ent
IEA biological process
GO:0021954 central nervous system ne
uron development
IEA biological process
GO:0023019 signal transduction invol
ved in regulation of gene
expression
IEA biological process
GO:0030154 cell differentiation
IEA biological process
GO:0030324 lung development
IEA biological process
GO:0030509 BMP signaling pathway
IEA biological process
GO:0030539 male genitalia developmen
t
IEA biological process
GO:0030878 thyroid gland development
IEA biological process
GO:0030916 otic vesicle formation
IEA biological process
GO:0030917 midbrain-hindbrain bounda
ry development
IEA biological process
GO:0033563 dorsal/ventral axon guida
nce
IEA biological process
GO:0035050 embryonic heart tube deve
lopment
IEA biological process
GO:0035108 limb morphogenesis
IEA biological process
GO:0035116 embryonic hindlimb morpho
genesis
IEA biological process
GO:0035909 aorta morphogenesis
IEA biological process
GO:0036092 phosphatidylinositol-3-ph
osphate biosynthetic proc
ess
IEA biological process
GO:0042056 chemoattractant activity
IEA molecular function
GO:0042472 inner ear morphogenesis
IEA biological process
GO:0042476 odontogenesis
IEA biological process
GO:0042476 odontogenesis
IEP biological process
GO:0042487 regulation of odontogenes
is of dentin-containing t
ooth
IEA biological process
GO:0042493 response to drug
IEA biological process
GO:0043066 negative regulation of ap
optotic process
IEA biological process
GO:0043524 negative regulation of ne
uron apoptotic process
IEA biological process
GO:0043547 positive regulation of GT
Pase activity
IEA biological process
GO:0045165 cell fate commitment
IEA biological process
GO:0045840 positive regulation of mi
totic nuclear division
IEA biological process
GO:0046622 positive regulation of or
gan growth
IEA biological process
GO:0046854 phosphatidylinositol phos
phorylation
IEA biological process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological process
GO:0048699 generation of neurons
IEA biological process
GO:0048853 forebrain morphogenesis
IEA biological process
GO:0050918 positive chemotaxis
IEA biological process
GO:0051781 positive regulation of ce
ll division
IEA biological process
GO:0055026 negative regulation of ca
rdiac muscle tissue devel
opment
IMP biological process
GO:0060037 pharyngeal system develop
ment
IEA biological process
GO:0060070 canonical Wnt signaling p
athway
IEA biological process
GO:0060128 corticotropin hormone sec
reting cell differentiati
on
IEA biological process
GO:0060129 thyroid-stimulating hormo
ne-secreting cell differe
ntiation
IEA biological process
GO:0060348 bone development
IMP biological process
GO:0060425 lung morphogenesis
IEA biological process
GO:0060445 branching involved in sal
ivary gland morphogenesis
IEA biological process
GO:0060563 neuroepithelial cell diff
erentiation
IDA biological process
GO:0070374 positive regulation of ER
K1 and ERK2 cascade
IEA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
IDA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
TAS biological process
GO:0090134 cell migration involved i
n mesendoderm migration
IEA biological process
GO:0000165 MAPK cascade
TAS biological process
GO:0001656 metanephros development
IEP biological process
GO:0001823 mesonephros development
IEP biological process
GO:0003148 outflow tract septum morp
hogenesis
ISS biological process
GO:0003198 epithelial to mesenchymal
transition involved in e
ndocardial cushion format
ion
ISS biological process
GO:0004713 protein tyrosine kinase a
ctivity
TAS molecular function
GO:0005088 Ras guanyl-nucleotide exc
hange factor activity
TAS molecular function
GO:0005105 type 1 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005111 type 2 fibroblast growth
factor receptor binding
IDA molecular function
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005576 extracellular region
TAS cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0005615 extracellular space
IDA cellular component
GO:0007369 gastrulation
NAS biological process
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008083 growth factor activity
IDA molecular function
GO:0008284 positive regulation of ce
ll proliferation
IDA biological process
GO:0008406 gonad development
IMP biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
IGI biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0008543 fibroblast growth factor
receptor signaling pathwa
y
TAS biological process
GO:0009653 anatomical structure morp
hogenesis
NAS biological process
GO:0010628 positive regulation of ge
ne expression
TAS biological process
GO:0014066 regulation of phosphatidy
linositol 3-kinase signal
ing
TAS biological process
GO:0016303 1-phosphatidylinositol-3-
kinase activity
TAS molecular function
GO:0042476 odontogenesis
IEP biological process
GO:0046934 phosphatidylinositol-4,5-
bisphosphate 3-kinase act
ivity
TAS molecular function
GO:0048015 phosphatidylinositol-medi
ated signaling
TAS biological process
GO:0055026 negative regulation of ca
rdiac muscle tissue devel
opment
IMP biological process
GO:0060348 bone development
IMP biological process
GO:0060563 neuroepithelial cell diff
erentiation
IDA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
IDA biological process
GO:0071542 dopaminergic neuron diffe
rentiation
TAS biological process

KEGG pathways

Expand All | Collapse All

Pathway idPathway name
hsa04151PI3K-Akt signaling pathway
hsa04810Regulation of actin cytoskeleton
hsa05200Pathways in cancer
hsa05226Gastric cancer
hsa05218Melanoma
hsa05224Breast cancer
Associated diseases References
Cleft defects GAD: 20634891
Male factor infertility MIK: 20463092
Hypospadias GAD: 17264867
Hypogonadotropic hypogonadism MIK: 20463092, OMIM: 600483, KEGG: H00255
Aberrant CpGs in Low Motility Sperm MIK: 21674046
Cryptorchidism MIK: 25131394
IHH MIK: 20463092
Spermatogenic defects MIK: 31037746
Teratozoospermia MIK: 17327269

PubMed references

Expand All | Collapse All

PMID Condition Mutation Ethnicity Population details Infertility_type Associated_genes Abstract
20463092 IHH
p.R127X and p.R129X
152 (2 familial
IHH patients,
100 controls)
Male infertility, Female infertility
Show abstract
17327269 Teratozoos
permia

13 (5 controls,
8 cases)
Male infertility GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
Show abstract
21674046 Aberrant C
pGs in Low
Motility
Sperm

18
Male infertility GSE26881
Show abstract
31037746 Spermatoge
nic defect
s

16 (1 control,
15 cases)
Male infertility GSE6023 analyzed using GEO2R
Show abstract
25131394 Cryptorchi
dism
p.Pro26Leu, p.Gly29_Arg34dup
76 (49 patients
with VATER/VAC
TERL associatio
n and 27 patien
ts presenting w
ith a VATER/VAC
TERL-like pheno
type (two cardi
nal features))
Male infertility
Show abstract