• Gene id: 2252

Gene Summary

• Gene Symbol: FGF7   Gene   UCSC   Ensembl
• Aliases: HBGF-7, KGF
• Gene name: fibroblast growth factor 7
• Alternate names: fibroblast growth factor 7, FGF-7, heparin-binding growth factor 7, keratinocyte growth factor,
• Gene location: 15q21.2 (49423241: 49488774)     Exons: 4     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel

Protein Summary

• Protein general information: P21781  
  • Name: Fibroblast growth factor 7 (FGF 7) (Heparin binding growth factor 7) (HBGF 7) (Keratinocyte growth factor)
  • Length: 194  
  • Mass: 22509
  • Tissue specificity: Epithelial cell.
• Sequence:

  MHKWILTWILPTLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQW
  YLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNT
  YASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

• Structural information:
  • Interpro: IPR028247  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • DIP: 4010
  • STRING: ENSP00000267843
• Other Databases: GeneCards:  FGF7  Malacards:  FGF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008083	growth factor activity	IEA	molecular function
GO:0008201	heparin binding	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0008544	epidermis development	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0060501	positive regulation of epithelial cell proliferation involved in lung morphogenesis	IDA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0060665	regulation of branching involved in salivary gland morphogenesis by mesenchymal-epithelial signaling	IEA	biological process
GO:0060445	branching involved in salivary gland morphogenesis	IEA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0031069	hair follicle morphogenesis	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0061033	secretion by lung epithelial cell involved in lung growth	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IDA	biological process
GO:0010463	mesenchymal cell proliferation	IDA	biological process
GO:0051549	positive regulation of keratinocyte migration	IDA	biological process
GO:0034394	protein localization to cell surface	IDA	biological process
GO:0031532	actin cytoskeleton reorganization	IDA	biological process
GO:0010838	positive regulation of keratinocyte proliferation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa05218	Melanoma

Diseases

Associated diseases	References
Prostate cancer	PMID:9285567
Prostatic hypertrophy	PMID:11482780
leiomyoma	PMID:18566572
Squamous cell carcinoma	PMID:17306351
Ovarian cancer	PMID:11000522
Endometrial carcinoma	PMID:9070494
Cervical squamous cell carcinoma	PMID:17306351
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881