• Gene id: 2247

Gene Summary

• Gene Symbol: FGF2   Gene   UCSC   Ensembl
• Aliases: BFGF, FGF-2, FGFB, HBGF-2
• Gene name: fibroblast growth factor 2
• Alternate names: fibroblast growth factor 2, basic fibroblast growth factor bFGF, fibroblast growth factor 2 (basic), heparin-binding growth factor 2, prostatropin,
• Gene location: 4q28.1 (122826707: 122898235)     Exons: 3     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as lim

Protein Summary

• Protein general information: P09038  
  • Name: Fibroblast growth factor 2 (FGF 2) (Basic fibroblast growth factor) (bFGF) (Heparin binding growth factor 2) (HBGF 2)
  • Length: 288  
  • Mass: 30770
  • Tissue specificity: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue. {ECO
• Sequence:

  MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPS
  GSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGG
  SGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLL
  ASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

• Structural information:
  • Interpro: IPR028223  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • PDB: 1BAS 1BFB 1BFC 1BFF 1BFG 1BLA 1BLD 1CVS 1EV2 1FGA 1FQ9 1II4 1IIL 2BFH 2FGF 2M49 4FGF 4OEE 4OEF 4OEG 5X1O
  • PDBsum: 1BAS 1BFB 1BFC 1BFF 1BFG 1BLA 1BLD 1CVS 1EV2 1FGA 1FQ9 1II4 1IIL 2BFH 2FGF 2M49 4FGF 4OEE 4OEF 4OEG 5X1O
  • DIP: 4012
  • STRING: ENSP00000264498
• Other Databases: GeneCards:  FGF2  Malacards:  FGF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038001	paracrine signaling	ISS	biological process
GO:0090722	receptor-receptor interaction	IDA	molecular function
GO:0072089	stem cell proliferation	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048598	embryonic morphogenesis	TAS	biological process
GO:0042060	wound healing	TAS	biological process
GO:0010863	positive regulation of phospholipase C activity	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IDA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0045765	regulation of angiogenesis	TAS	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0032958	inositol phosphate biosynthetic process	IDA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IDA	biological process
GO:0006661	phosphatidylinositol biosynthetic process	IDA	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006935	chemotaxis	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005615	extracellular space	TAS	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0007265	Ras protein signal transduction	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0009887	animal organ morphogenesis	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0042660	positive regulation of cell fate specification	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0014843	growth factor dependent regulation of skeletal muscle satellite cell proliferation	IMP	biological process
GO:0000165	MAPK cascade	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005125	cytokine activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0042056	chemoattractant activity	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0060045	positive regulation of cardiac muscle cell proliferation	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0019956	chemokine binding	IPI	molecular function
GO:0002042	cell migration involved in sprouting angiogenesis	IDA	biological process
GO:0043537	negative regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0090049	regulation of cell migration involved in sprouting angiogenesis	NAS	biological process
GO:2000544	regulation of endothelial cell chemotaxis to fibroblast growth factor	NAS	biological process
GO:1905564	positive regulation of vascular endothelial cell proliferation	IGI	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IGI	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IGI	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IMP	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	NAS	biological process
GO:0010629	negative regulation of gene expression	NAS	biological process
GO:0010629	negative regulation of gene expression	NAS	biological process
GO:0040037	negative regulation of fibroblast growth factor receptor signaling pathway	NAS	biological process
GO:1903587	regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis	NAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0050918	positive chemotaxis	IEA	biological process
GO:2000544	regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	biological process
GO:0060548	negative regulation of cell death	IDA	biological process
GO:2000546	positive regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	biological process
GO:0030374	nuclear receptor transcription coactivator activity	IDA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0030214	hyaluronan catabolic process	IDA	biological process
GO:0010764	negative regulation of fibroblast migration	IDA	biological process
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0061045	negative regulation of wound healing	IDA	biological process
GO:0060591	chondroblast differentiation	IDA	biological process
GO:0001658	branching involved in ureteric bud morphogenesis	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0090050	positive regulation of cell migration involved in sprouting angiogenesis	IDA	biological process
GO:0043536	positive regulation of blood vessel endothelial cell migration	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IDA	biological process
GO:0005178	integrin binding	IDA	molecular function
GO:0042060	wound healing	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IDA	biological process
GO:1902748	positive regulation of lens fiber cell differentiation	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045766	positive regulation of angiogenesis	IGI	biological process
GO:2001028	positive regulation of endothelial cell chemotaxis	IGI	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IGI	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa05205	Proteoglycans in cancer
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05226	Gastric cancer
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa05224	Breast cancer
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa05218	Melanoma

Diseases

Associated diseases	References
Endometriosis	INFBASE: 15672963
Female infertility	INFBASE: 15672963
Pterygium	PMID:20198298
Bone disease	PMID:17066631
Multiple endocrine neoplasia	PMID:8098714
Cholesteatoma of middle ear	PMID:11078065
urinary bladder cancer	PMID:11908679
Corneal neovascularization	PMID:11437330
leiomyoma	PMID:16139411
Endometrial cancer	PMID:8685603
Cognitive disorder	PMID:17955369
Breast cancer	PMID:12184408
Breast cancer	PMID:14715109
pancreatic cancer	PMID:11478488
pancreatic cancer	PMID:12670449
Impotence	PMID:15758817
Ovarian cancer	PMID:14613644
prostate adenocarcinoma	PMID:14522896
Transitional cell carcinoma	PMID:7549793
Dermatitis	PMID:16507899
Coronary artery disease	PMID:14585103
Breast carcinoma	PMID:8532703
pancreatic ductal carcinoma	PMID:18704599
pancreatic ductal carcinoma	PMID:12717266
macular retinal edema	PMID:17505145
renal cell carcinoma	PMID:1718278
cholangiocarcinoma	PMID:11478488
esophageal cancer	PMID:29660336
Pulmonary hypertension	PMID:19197140
Cataract	PMID:19491954
Diabetic retinopathy	PMID:9141532
Diabetic retinopathy	PMID:17997184
type 2 diabetes mellitus	PMID:18279437
Neovascular inflammatory vitreoretinopathy	PMID:9613386
Biliary tract disease	PMID:11478488
Diabetic neuropathy	PMID:16644707
Polyarteritis nodosa	PMID:15965421
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881