• Gene id: 2246

Gene Summary

• Gene Symbol: FGF1   Gene   UCSC   Ensembl
• Aliases: AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-1, FGF-alpha, FGFA, GLIO703, HBGF-1, HBGF1
• Gene name: fibroblast growth factor 1
• Alternate names: fibroblast growth factor 1, beta-endothelial cell growth factor, endothelial cell growth factor, alpha, endothelial cell growth factor, beta, fibroblast growth factor 1 (acidic), heparin-binding growth factor 1,
• Gene location: 5q31.3 (142698069: 142592177)     Exons: 11     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cel
• OMIM: 606974

Protein Summary

• Protein general information: P05230  
  • Name: Fibroblast growth factor 1 (FGF 1) (Acidic fibroblast growth factor) (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin binding growth factor 1) (HBGF 1)
  • Length: 155  
  • Mass: 17460
  • Tissue specificity: Predominantly expressed in kidney and brain. Detected at much lower levels in heart and skeletal muscle. {ECO
• Sequence:

  MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTE
  TGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPL
  PVSSD

• Structural information:
  • Interpro: IPR028210  IPR002209  IPR008996  
  • Prosite: PS00247
  • CDD: cd00058
  • PDB: 1AXM 1DJS 1DZC 1DZD 1E0O 1EVT 1HKN 1JQZ 1JT3 1JT4 1JT5 1JT7 1JTC 1JY0 1K5U 1K5V 1M16 1NZK 1P63 1PZZ 1Q03 1Q04 1QCT 1RG8 1RML 1RY7 1YTO 1Z2V 1Z4S 2AFG 2AQZ 2AXM 2ERM 2HW9 2HWA 2HWM 2HZ9 2K43 2K4A 2K8R 2KI4 2KI6 2NTD 2Q9X 2RQ9 3B9U 3BA4 3BA5 3BA7 3BAD 3BAG 3BAH 3BAO 3BAQ 3BAU 3BAV 3BB2 3CQA 3CRG 3CRH 3CRI 3CU1 3FGM 3FJ
  • PDBsum: 1AXM 1DJS 1DZC 1DZD 1E0O 1EVT 1HKN 1JQZ 1JT3 1JT4 1JT5 1JT7 1JTC 1JY0 1K5U 1K5V 1M16 1NZK 1P63 1PZZ 1Q03 1Q04 1QCT 1RG8 1RML 1RY7 1YTO 1Z2V 1Z4S 2AFG 2AQZ 2AXM 2ERM 2HW9 2HWA 2HWM 2HZ9 2K43 2K4A 2K8R 2KI4 2KI6 2NTD 2Q9X 2RQ9 3B9U 3BA4 3BA5 3BA7 3BAD 3BAG 3BAH 3BAO 3BAQ 3BAU 3BAV 3BB2 3CQA 3CRG 3CRH 3CRI 3CU1 3FGM 3FJ
  • DIP: 3787
  • STRING: ENSP00000480791
• Other Databases: GeneCards:  FGF1  Malacards:  FGF1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051781	positive regulation of cell division	IDA	biological process
GO:0034605	cellular response to heat	IDA	biological process
GO:0030335	positive regulation of cell migration	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0008083	growth factor activity	IDA	molecular function
GO:0000187	activation of MAPK activity	IMP	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:1901509	regulation of endothelial tube morphogenesis	IMP	biological process
GO:0010595	positive regulation of endothelial cell migration	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005104	fibroblast growth factor receptor binding	IMP	molecular function
GO:0032148	activation of protein kinase B activity	IMP	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IMP	biological process
GO:0008201	heparin binding	IMP	molecular function
GO:1903672	positive regulation of sprouting angiogenesis	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005104	fibroblast growth factor receptor binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0008083	growth factor activity	TAS	molecular function
GO:0007275	multicellular organism development	TAS	biological process
GO:0007165	signal transduction	NAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008284	positive regulation of cell population proliferation	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IPI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	IGI	biological process
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0005104	fibroblast growth factor receptor binding	IPI	molecular function
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0008543	fibroblast growth factor receptor signaling pathway	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0000165	MAPK cascade	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0031012	extracellular matrix	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:2000347	positive regulation of hepatocyte proliferation	IEA	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0030324	lung development	IEA	biological process
GO:0001934	positive regulation of protein phosphorylation	IEA	biological process
GO:0001759	organ induction	IEA	biological process
GO:0030544	Hsp70 protein binding	IEA	molecular function
GO:0008083	growth factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045542	positive regulation of cholesterol biosynthetic process	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:1902533	positive regulation of intracellular signal transduction	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0060681	branch elongation involved in ureteric bud branching	IDA	biological process
GO:2000544	regulation of endothelial cell chemotaxis to fibroblast growth factor	IDA	biological process
GO:0072163	mesonephric epithelium development	IDA	biological process
GO:0042060	wound healing	IDA	biological process
GO:0043406	positive regulation of MAP kinase activity	IDA	biological process
GO:0044548	S100 protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04390	Hippo signaling pathway
hsa05226	Gastric cancer
hsa05224	Breast cancer
hsa05218	Melanoma

Diseases

Associated diseases	References
Alzheimer's disease	PMID:20079650
urinary bladder cancer	PMID:11908679
leiomyoma	PMID:16139411
Endometrial cancer	PMID:8685603
Brain ischemia	PMID:16635575
Ovarian cancer	PMID:14613644
Transitional cell carcinoma	PMID:7690426
Schizophrenia	PMID:17893707
Myocardial infarction	PMID:24200746
Cleft lip	PMID:24613087
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray