• Gene id: 2243

Gene Summary

• Gene Symbol: FGA   Gene   UCSC   Ensembl
• Aliases: Fib2
• Gene name: fibrinogen alpha chain
• Alternate names: fibrinogen alpha chain, fibrinogen, A alpha polypeptide,
• Gene location: 4q31.3 (154590741: 154583125)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes the alpha subunit of the coagulation factor fibrinogen, which is a component of the blood clot. Following vascular injury, the encoded preproprotein is proteolytically processed by thrombin during the conversion of fibrinogen to fibrin.
• OMIM: 109092

Protein Summary

• Protein general information: P02671  
  • Name: Fibrinogen alpha chain [Cleaved into: Fibrinopeptide A; Fibrinogen alpha chain]
  • Length: 866  
  • Mass: 94973
  • Tissue specificity: Detected in blood plasma (at protein level). {ECO
• Sequence:

  MFSMRIVCLVLSVVGTAWTADSGEGDFLAEGGGVRGPRVVERHQSACKDSDWPFCSDEDWNYKCPSGCRMKGLID
  EVNQDFTNRINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKRKVIEKVQ
  HIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLPSRDRQHLPLIK
  MKPVPDLVPGNFKSQLQKVPPEWKALTDMPQMRMELERPGGNEITRGGSTSYGTGSETESPRNPSSAGSWNSGSS
  GPGSTGNRNPGSSGTGGTATWKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSAGHWTS
  ESSVSGSTGQWHSESGSFRPDSPGSGNARPNNPDWGTFEEVSGNVSPGTRREYHTEKLVTSKGDKELRTGKEKVT
  SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTLSGIGTLDGFRHRHPDEAAFFDTAST
  GKTFPGFFSPMLGEFVSETESRGSESGIFTNTKESSSHHPGIAEFPSRGKSSSYSKQFTSSTSYNRGDSTFESKS
  YKMADEAGSEADHEGTHSTKRGHAKSRPVRDCDDVLQTHPSGTQSGIFNIKLPGSSKIFSVYCDQETSLGGWLLI
  QQRMDGSLNFNRTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVELEDWAGNEAYAEYHFRVGSEAEG
  YALQVSSYEGTAGDALIEGSVEEGAEYTSHNNMQFSTFDRDADQWEENCAEVYGGGWWYNNCQAANLNGIYYPGG
  SYDPRNNSPYEIENGVVWVSFRGADYSLRAVRMKIRPLVTQ

• Structural information:
  • Protein Domains: (623..86-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR036056  IPR002181  IPR012290  IPR021996  IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 1BBR 1DM4 1FPH 1FZA 1FZB 1FZC 1FZD 1FZE 1FZF 1FZG 1LT9 1LTJ 1N86 1N8E 1RE3 1RE4 1RF0 1RF1 1YCP 2A45 2FFD 2H43 2HLO 2HOD 2HPC 2OYH 2OYI 2Q9I 2XNX 2XNY 2Z4E 3AT0 3BVH 3E1I 3GHG 3H32 3HUS 4F27 5CFA
  • PDBsum: 1BBR 1DM4 1FPH 1FZA 1FZB 1FZC 1FZD 1FZE 1FZF 1FZG 1LT9 1LTJ 1N86 1N8E 1RE3 1RE4 1RF0 1RF1 1YCP 2A45 2FFD 2H43 2HLO 2HOD 2HPC 2OYH 2OYI 2Q9I 2XNX 2XNY 2Z4E 3AT0 3BVH 3E1I 3GHG 3H32 3HUS 4F27 5CFA
  • DIP: 29643
  • STRING: ENSP00000306361
• Other Databases: GeneCards:  FGA  Malacards:  FGA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043152	induction of bacterial agglutination	IDA	biological process
GO:0005577	fibrinogen complex	IBA	cellular component
GO:0072377	blood coagulation, common pathway	IBA	biological process
GO:0090277	positive regulation of peptide hormone secretion	IBA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IBA	biological process
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IBA	biological process
GO:0042730	fibrinolysis	IBA	biological process
GO:0051258	protein polymerization	IBA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IBA	biological process
GO:0070527	platelet aggregation	IBA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IBA	biological process
GO:0005577	fibrinogen complex	IEA	cellular component
GO:0007596	blood coagulation	IEA	biological process
GO:0030168	platelet activation	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0051258	protein polymerization	IEA	biological process
GO:0007596	blood coagulation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0007599	hemostasis	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0005577	fibrinogen complex	TAS	cellular component
GO:0002224	toll-like receptor signaling pathway	TAS	biological process
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0030198	extracellular matrix organization	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0044267	cellular protein metabolic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005788	endoplasmic reticulum lumen	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007596	blood coagulation	IEA	biological process
GO:0005938	cell cortex	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005198	structural molecule activity	IDA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0090277	positive regulation of peptide hormone secretion	IDA	biological process
GO:1902042	negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	IDA	biological process
GO:0005102	signaling receptor binding	IDA	contributes to
GO:0050839	cell adhesion molecule binding	IDA	contributes to
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005198	structural molecule activity	IMP	molecular function
GO:0034116	positive regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0034622	cellular protein-containing complex assembly	IDA	biological process
GO:0045907	positive regulation of vasoconstriction	IDA	biological process
GO:0045921	positive regulation of exocytosis	IDA	biological process
GO:0050714	positive regulation of protein secretion	IDA	biological process
GO:0051258	protein polymerization	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070527	platelet aggregation	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0072377	blood coagulation, common pathway	IMP	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	NAS	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005201	extracellular matrix structural constituent	HDA	molecular function
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0051592	response to calcium ion	IDA	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0031091	platelet alpha granule	IDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031639	plasminogen activation	IDA	biological process
GO:0072378	blood coagulation, fibrin clot formation	IDA	biological process
GO:0042730	fibrinolysis	IDA	biological process
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0005577	fibrinogen complex	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0072562	blood microparticle	HDA	cellular component
GO:0065003	protein-containing complex assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component
GO:0005576	extracellular region	NAS	cellular component
GO:0070527	platelet aggregation	HMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04611	Platelet activation
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Inherited thrombophilia	KEGG:H00223
Afibrinogenemia	KEGG:H00222
Familial amyloidosis	KEGG:H00845
Inherited thrombophilia	KEGG:H00223
Afibrinogenemia	KEGG:H00222
Familial amyloidosis	KEGG:H00845
Keratoconus	PMID:24194634
Congenital afibrinogenemia	PMID:15795544
Thrombophilia	PMID:10910940
Crohn's disease	PMID:19683480
type 2 diabetes mellitus	PMID:7974333
acute lymphocytic leukemia	PMID:25317080
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray