• Gene id: 2242

Gene Summary

• Gene Symbol: FES   Gene   UCSC   Ensembl
• Aliases: FPS
• Gene name: FES proto-oncogene, tyrosine kinase
• Alternate names: tyrosine-protein kinase Fes/Fps, Oncogene FES, feline sarcoma virus, feline sarcoma (Snyder-Theilen) viral (v-fes)/Fujinami avian sarcoma (PRCII) viral (v-fps) oncogene homolog, feline sarcoma oncogene, feline sarcoma/Fujinami avian sarcoma oncogene homolog, p,
• Gene location: 15q26.1 (90884420: 90895775)     Exons: 19     NC_000015.10
• Gene summary(Entrez): This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation
• OMIM: 605182

Protein Summary

• Protein general information: P07332  
  • Name: Tyrosine protein kinase Fes/Fps (EC 2.7.10.2) (Feline sarcoma/Fujinami avian sarcoma oncogene homolog) (Proto oncogene c Fes) (Proto oncogene c Fps) (p93c fes)
  • Length: 822  
  • Mass: 93497
  • Tissue specificity: Widely expressed. Detected in adult colon epithelium (at protein level) (PubMed
• Sequence:

  MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQSRAISPDSPISQSWAE
  ITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQWQQLQQELTKTHSQDIEKLKSQYRALARDSA
  QAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKE
  ILQEYLEISSLVQDEVVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
  LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVLQEALQGLQVALCSQA
  KLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGRTPTLEILKSHISGIFRPKFSLPPPLQLIPE
  VQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPL
  LIDHLLSTQQPLTKKSGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
  KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTLLQMVGDAAAGMEYLE
  SKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLRQVPVKWTAPEALNYGRYSSESDVWSFGILL
  WETFSLGASPYPNLSNQQTREFVEKGGRLPCPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR

• Structural information:
  • Protein Domains: (1..26-)
    (/note="F-BAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01077-)
    (460..54-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (561..82-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR027267  IPR031160  IPR001060  IPR035849  IPR011009   IPR000719  IPR017441  IPR001245  IPR000980  IPR036860  IPR016250  IPR008266  IPR020635  
  • Prosite: PS51741 PS00107 PS50011 PS00109 PS50001
  • CDD: cd10361
  • PDB: 1WQU 2DCR 3BKB 3CBL 3CD3 4DYL 4E93 6JMF
  • PDBsum: 1WQU 2DCR 3BKB 3CBL 3CD3 4DYL 4E93 6JMF
  • STRING: ENSP00000331504
• Other Databases: GeneCards:  FES  Malacards:  FES

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045657	positive regulation of monocyte differentiation	IMP	biological process
GO:0071305	cellular response to vitamin D	IMP	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0007155	cell adhesion	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0043304	regulation of mast cell degranulation	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0031410	cytoplasmic vesicle	IDA	colocalizes with
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0004713	protein tyrosine kinase activity	IDA	molecular function
GO:0035091	phosphatidylinositol binding	IDA	molecular function
GO:0034987	immunoglobulin receptor binding	IDA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:2000145	regulation of cell motility	IMP	biological process
GO:0060627	regulation of vesicle-mediated transport	TAS	biological process
GO:0045639	positive regulation of myeloid cell differentiation	IMP	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:2000251	positive regulation of actin cytoskeleton reorganization	IMP	biological process
GO:0045595	regulation of cell differentiation	IMP	biological process
GO:0043304	regulation of mast cell degranulation	IMP	biological process
GO:0010976	positive regulation of neuron projection development	IMP	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0008017	microtubule binding	IEA	molecular function
GO:0007098	centrosome cycle	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0001578	microtubule bundle formation	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq