• Gene id: 2241

Gene Summary

• Gene Symbol: FER   Gene   UCSC   Ensembl
• Aliases: PPP1R74, TYK3, p94-Fer
• Gene name: FER tyrosine kinase
• Alternate names: tyrosine-protein kinase Fer, feline encephalitis virus-related kinase FER, fer (fps/fes related) tyrosine kinase, fujinami poultry sarcoma/Feline sarcoma-related protein Fer, phosphoprotein NCP94, protein phosphatase 1, regulatory subunit 74, proto-oncogene c-F,
• Gene location: 5q21.3 (108746084: 109196840)     Exons: 30     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative sp
• OMIM: 176942

Protein Summary

• Protein general information: P16591  
  • Name: Tyrosine protein kinase Fer (EC 2.7.10.2) (Feline encephalitis virus related kinase FER) (Fujinami poultry sarcoma/Feline sarcoma related protein Fer) (Proto oncogene c Fer) (Tyrosine kinase 3) (p94 Fer)
  • Length: 822  
  • Mass: 94638
  • Tissue specificity: Isoform 1 is detected in normal colon and in fibroblasts (at protein level). Isoform 3 is detected in normal testis, in colon carcinoma-derived metastases in lung, liver and ovary, and in colon carcinoma and hepato carcinoma cell lines
• Sequence:

  MGFGSDLKNSHEAVLKLQDWELRLLETVKKFMALRIKSDKEYASTLQNLCNQVDKESTVQMNYVSNVSKSWLLMI
  QQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIEAEMIKVTKTELEKLKCSYRQLIKEMNSA
  KEKYKEALAKGKETEKAKERYDKATMKLHMLHNQYVLALKGAQLHQNQYYDITLPLLLDSLQKMQEEMIKALKGI
  FDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNL
  TAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEA
  KFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI
  SEKPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQRRHFIIQYVDNMYRFEGTGFSNIP
  QLIDHHYTTKQVITKKSGVVLLNPIPKDKKWILSHEDVILGELLGKGNFGEVYKGTLKDKTSVAVKTCKEDLPQE
  LKIKFLQEAKILKQYDHPNIVKLIGVCTQRQPVYIIMELVSGGDFLTFLRRKKDELKLKQLVKFSLDAAAGMLYL
  ESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLKQIPIKWTAPEALNYGRYSSESDVWSFGILL
  WETFSLGVCPYPGMTNQQAREQVERGYRMSAPQHCPEDISKIMMKCWDYKPENRPKFSELQKELTIIKRKLT

• Structural information:
  • Protein Domains: (1..25-)
    (/note="F-BAR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01077-)
    (460..55-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (563..81-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR027267  IPR031160  IPR001060  IPR028539  IPR037452   IPR035849  IPR011009  IPR000719  IPR017441  IPR001245  IPR000980  IPR036860  IPR016250  IPR008266  IPR020635  
  • Prosite: PS51741 PS00107 PS50011 PS00109 PS50001
  • CDD: cd07686 cd10361
  • PDB: 2KK6 6KC4
  • PDBsum: 2KK6 6KC4
  • STRING: ENSP00000281092
• Other Databases: GeneCards:  FER  Malacards:  FER

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IBA	molecular function
GO:0016477	cell migration	IBA	biological process
GO:0030154	cell differentiation	IBA	biological process
GO:0038083	peptidyl-tyrosine autophosphorylation	IBA	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	IBA	biological process
GO:0042127	regulation of cell population proliferation	IBA	biological process
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0006935	chemotaxis	IBA	biological process
GO:0007155	cell adhesion	IBA	biological process
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IBA	cellular component
GO:0043304	regulation of mast cell degranulation	IBA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0007260	tyrosine phosphorylation of STAT protein	IDA	biological process
GO:0030054	cell junction	IDA	colocalizes with
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0018108	peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0015630	microtubule cytoskeleton	IDA	colocalizes with
GO:0015629	actin cytoskeleton	IDA	colocalizes with
GO:0010591	regulation of lamellipodium assembly	IDA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0005154	epidermal growth factor receptor binding	IDA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IDA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0030027	lamellipodium	IDA	colocalizes with
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	colocalizes with
GO:0070102	interleukin-6-mediated signaling pathway	IMP	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	ISS	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0038109	Kit signaling pathway	ISS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	ISS	biological process
GO:0036119	response to platelet-derived growth factor	ISS	biological process
GO:0034614	cellular response to reactive oxygen species	ISS	biological process
GO:0033007	negative regulation of mast cell activation involved in immune response	ISS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0030335	positive regulation of cell migration	IMP	biological process
GO:0019221	cytokine-mediated signaling pathway	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	TAS	biological process
GO:0050904	diapedesis	ISS	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	TAS	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	ISS	biological process
GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	ISS	biological process
GO:0036006	cellular response to macrophage colony-stimulating factor stimulus	IMP	biological process
GO:0035426	extracellular matrix-cell signaling	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	ISS	biological process
GO:0032496	response to lipopolysaccharide	ISS	biological process
GO:0031532	actin cytoskeleton reorganization	ISS	biological process
GO:0030838	positive regulation of actin filament polymerization	IMP	biological process
GO:0001932	regulation of protein phosphorylation	ISS	biological process
GO:0000226	microtubule cytoskeleton organization	IMP	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0005154	epidermal growth factor receptor binding	IEA	molecular function
GO:0018108	peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0030335	positive regulation of cell migration	IEA	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IEA	biological process
GO:0051092	positive regulation of NF-kappaB transcription factor activity	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0004713	protein tyrosine kinase activity	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0004713	protein tyrosine kinase activity	TAS	molecular function
GO:0006468	protein phosphorylation	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0004715	non-membrane spanning protein tyrosine kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0044331	cell-cell adhesion mediated by cadherin	IEA	biological process
GO:0038109	Kit signaling pathway	IEA	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	IEA	biological process
GO:0036119	response to platelet-derived growth factor	IEA	biological process
GO:0034614	cellular response to reactive oxygen species	IEA	biological process
GO:0033007	negative regulation of mast cell activation involved in immune response	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0008157	protein phosphatase 1 binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0050904	diapedesis	IEA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0038028	insulin receptor signaling pathway via phosphatidylinositol 3-kinase	IEA	biological process
GO:0035426	extracellular matrix-cell signaling	IEA	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0032496	response to lipopolysaccharide	IEA	biological process
GO:0031532	actin cytoskeleton reorganization	IEA	biological process
GO:0010762	regulation of fibroblast migration	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0006935	chemotaxis	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0001932	regulation of protein phosphorylation	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04520	Adherens junction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq