• Gene id: 2239

Gene Summary

• Gene Symbol: GPC4   Gene   UCSC   Ensembl
• Aliases: K-glypican, KPTS
• Gene name: glypican 4
• Alternate names: glypican-4, dJ900E8.1 (glypican 4), glypican proteoglycan 4,
• Gene location: Xq26.2 (133415488: 133300102)     Exons: 9     NC_000023.11
• Gene summary(Entrez): Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protei

Protein Summary

• Protein general information: O75487  
  • Name: Glypican 4 (K glypican) [Cleaved into: Secreted glypican 4]
  • Length: 556  
  • Mass: 62412
• Sequence:

  MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYVSKGFNKNDAPLHEINGDHLKICPQGSTCCSQEMEEKY
  SLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYY
  VVGNVNLEEMLNDFWARLLERMFRLVNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGL
  AVAGDVVSKVSVVNPTAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
  RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESAFSARFRPHHPEERPT
  TAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEV
  QVDTSKPDILILRQIMALRVMTSKMKNAYNGNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANE
  KADSAGVRPGAQAYLLTVFCILFLVMQREWR

• Structural information:
  • Interpro: IPR001863  IPR031180  IPR019803  
  • Prosite: PS01207
  • STRING: ENSP00000359864
• Other Databases: GeneCards:  GPC4  Malacards:  GPC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904929	coreceptor activity involved in Wnt signaling pathway, planar cell polarity pathway	NAS	molecular function
GO:1905606	regulation of presynapse assembly	IBA	biological process
GO:1905475	regulation of protein localization to membrane	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0005576	extracellular region	IBA	cellular component
GO:0099560	synaptic membrane adhesion	IBA	biological process
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0009986	cell surface	IBA	cellular component
GO:0016055	Wnt signaling pathway	IMP	biological process
GO:0046658	anchored component of plasma membrane	IEA	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0009966	regulation of signal transduction	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0001523	retinoid metabolic process	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006024	glycosaminoglycan biosynthetic process	TAS	biological process
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0043202	lysosomal lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0005796	Golgi lumen	TAS	cellular component
GO:0006027	glycosaminoglycan catabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098696	regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA	biological process
GO:0099026	anchored component of presynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005634	nucleus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Keipert syndrome	KEGG:H02326
Keipert syndrome	KEGG:H02326
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881