• Gene id: 2237

Gene Summary

• Gene Symbol: FEN1   Gene   UCSC   Ensembl
• Aliases: FEN-1, MF1, RAD2
• Gene name: flap structure-specific endonuclease 1
• Alternate names: flap endonuclease 1, DNase IV, maturation factor-1,
• Gene location: 11q12.2 (61792910: 61797237)     Exons: 2     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excis
• OMIM: 600393

Protein Summary

• Protein general information: P39748  
  • Name: Flap endonuclease 1 (FEN 1) (EC 3.1. . ) (DNase IV) (Flap structure specific endonuclease 1) (Maturation factor 1) (MF1) (hFEN 1)
  • Length: 380  
  • Mass: 42593
• Sequence:

  MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLMGMFYRTIRMM
  ENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRLVKVTKQHNDECKHLLSLMGI
  PYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVD
  LCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
  PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGK
  FKRGK

• Structural information:
  • Interpro: IPR036279  IPR023426  IPR008918  IPR029060  IPR006086   IPR006084  IPR019974  IPR006085  
  • Prosite: PS00841 PS00842
  • PDB: 1U7B 1UL1 3Q8K 3Q8L 3Q8M 3UVU 5E0V 5FV7 5K97 5KSE 5UM9 5ZOD 5ZOE 5ZOF 5ZOG 6TNZ
  • PDBsum: 1U7B 1UL1 3Q8K 3Q8L 3Q8M 3UVU 5E0V 5FV7 5K97 5KSE 5UM9 5ZOD 5ZOE 5ZOF 5ZOG 6TNZ
  • DIP: 24216
  • STRING: ENSP00000305480
• Other Databases: GeneCards:  FEN1  Malacards:  FEN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0048256	flap endonuclease activity	IBA	molecular function
GO:0030145	manganese ion binding	IBA	molecular function
GO:0000287	magnesium ion binding	IBA	molecular function
GO:0017108	5'-flap endonuclease activity	IBA	molecular function
GO:0008409	5'-3' exonuclease activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0004523	RNA-DNA hybrid ribonuclease activity	IBA	molecular function
GO:0043137	DNA replication, removal of RNA primer	IDA	biological process
GO:0017108	5'-flap endonuclease activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0048256	flap endonuclease activity	IDA	molecular function
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IDA	biological process
GO:0045876	positive regulation of sister chromatid cohesion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0016788	hydrolase activity, acting on ester bonds	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004519	endonuclease activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0003690	double-stranded DNA binding	TAS	molecular function
GO:0004519	endonuclease activity	TAS	molecular function
GO:0003684	damaged DNA binding	TAS	molecular function
GO:0004527	exonuclease activity	TAS	molecular function
GO:0008309	double-stranded DNA exodeoxyribonuclease activity	TAS	molecular function
GO:0006302	double-strand break repair	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0009650	UV protection	TAS	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0000724	double-strand break repair via homologous recombination	TAS	biological process
GO:0017108	5'-flap endonuclease activity	TAS	molecular function
GO:0017108	5'-flap endonuclease activity	TAS	molecular function
GO:0017108	5'-flap endonuclease activity	TAS	molecular function
GO:0017108	5'-flap endonuclease activity	TAS	molecular function
GO:0017108	5'-flap endonuclease activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0032201	telomere maintenance via semi-conservative replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007613	memory	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0043137	DNA replication, removal of RNA primer	IEA	biological process
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0006284	base-excision repair	IEA	biological process
GO:0017108	5'-flap endonuclease activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0008409	5'-3' exonuclease activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0008409	5'-3' exonuclease activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004523	RNA-DNA hybrid ribonuclease activity	IDA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0017108	5'-flap endonuclease activity	IMP	molecular function
GO:0017108	5'-flap endonuclease activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03030	DNA replication
hsa03410	Base excision repair
hsa03450	Non-homologous end-joining

Diseases

Associated diseases	References
Breast cancer	PMID:19010819
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray