• Gene id: 2230

Gene Summary

• Gene Symbol: FDX1   Gene   UCSC   Ensembl
• Aliases: ADX, FDX, LOH11CR1D
• Gene name: ferredoxin 1
• Alternate names: adrenodoxin, mitochondrial, adrenal ferredoxin, hepatoredoxin, mitochondrial adrenodoxin,
• Gene location: 11q22.3 (110429947: 110464883)     Exons: 4     NC_000011.10
• Gene summary(Entrez): This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chr
• OMIM: 103260

Protein Summary

• Protein general information: P10109  
  • Name: Adrenodoxin, mitochondrial (Adrenal ferredoxin) (Ferredoxin 1) (Hepatoredoxin)
  • Length: 184  
  • Mass: 19393
  • Tissue specificity: Highest levels in the adrenal gland (at protein level). Also detected in kidney and testis (at protein level). {ECO
• Sequence:

  MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVHFINRD
  GETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRL
  GCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

• Structural information:
  • Protein Domains: (67..17-)
    (/note="2Fe-2S-ferredoxin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00465"-)
  • Interpro: IPR036010  IPR001041  IPR001055  IPR018298  IPR012675  
  • Prosite: PS51085 PS00814
  • CDD: cd00207
  • PDB: 3N9Y 3N9Z 3NA0 3NA1 3P1M
  • PDBsum: 3N9Y 3N9Z 3NA0 3NA1 3P1M
  • STRING: ENSP00000260270
• Other Databases: GeneCards:  FDX1  Malacards:  FDX1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042446	hormone biosynthetic process	IDA	biological process
GO:0051537	2 iron, 2 sulfur cluster binding	IDA	molecular function
GO:0009055	electron transfer activity	IDA	molecular function
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0009055	electron transfer activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006694	steroid biosynthetic process	IEA	biological process
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0008202	steroid metabolic process	IEA	biological process
GO:0005506	iron ion binding	TAS	molecular function
GO:0009055	electron transfer activity	TAS	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006700	C21-steroid hormone biosynthetic process	TAS	biological process
GO:0016125	sterol metabolic process	TAS	biological process
GO:0044281	small molecule metabolic process	TAS	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:1904322	cellular response to forskolin	IEA	biological process
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0005759	mitochondrial matrix	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881