• Gene id: 222643

Gene Summary

• Gene Symbol: UNC5CL   Gene   UCSC   Ensembl
• Aliases: MUXA, ZUD
• Gene name: unc-5 family C-terminal like
• Alternate names: UNC5C-like protein, ZU5 and death domain containing, protein unc-5 homolog C-like, unc-5 homolog C-like,
• Gene location: 6p21.1 (41039220: 41026894)     Exons: 9     NC_000006.12
• OMIM: 607770

Protein Summary

• Protein general information: Q8IV45  
  • Name: UNC5C like protein (Protein unc 5 homolog C like) (ZU5 and death domain containing protein)
  • Length: 518  
  • Mass: 57818
  • Tissue specificity: Expressed in pancreas, liver and kidney. {ECO
• Sequence:

  MCPQESSFQPSQFLLLVGVPVASVLLLAQCLRWHCPRRLLGACWTLNGQEEPVSQPTPQLENEVSRQHLPATLPE
  MVAFYQELHTPTQGQTMVRQLMHKLLVFSAREVDHRGGCLMLQDTGISLLIPPGAVAVGRQERVSLILVWDLSDA
  PSLSQAQGLVSPVVACGPHGASFLKPCTLTFKHCAEQPSHARTYSSNTTLLDAKVWRPLGRPGAHASRDECRIHL
  SHFSLYTCVLEAPVGREARKWLQLAVFCSPLVPGQSHLQLRIYFLNNTPCALQWALTNEQPHGGRLRGPCQLFDF
  NGARGDQCLKLTYISEGWENVDDSSCQLVPHLHIWHGKCPFRSFCFRRKAADENEDCSALTNEIIVTMHTFQDGL
  ETKYMEILRFQASEEESWAAPPPVSQPPPCNRLPPELFEQLRMLLEPNSITGNDWRRLASHLGLCGMKIRFLSCQ
  RSPAAAILELFEEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPGPERGGARDNQGLELDEKL

• Structural information:
  • Protein Domains: (102..23-)
    (/note="ZU5-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00485-)
    (415..49-)
    (/note="Death-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00064"-)
  • Interpro: IPR011029  IPR000488  IPR037936  IPR033772  IPR000906  
  • Prosite: PS50017 PS51145
  • STRING: ENSP00000244565
• Other Databases: GeneCards:  UNC5CL  Malacards:  UNC5CL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046330	positive regulation of JNK cascade	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0005042	netrin receptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0038007	netrin-activated signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0016020	membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006508	proteolysis	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881