• Gene id: 222229

Gene Summary

• Gene Symbol: LRWD1   Gene   UCSC   Ensembl
• Aliases: CENP-33, ORCA
• Gene name: leucine rich repeats and WD repeat domain containing 1
• Alternate names: leucine-rich repeat and WD repeat-containing protein 1, ORC-associated protein, centromere protein 33, origin recognition complex-associated protein, testicular tissue protein Li 4,
• Gene location: 7q22.1 (102464882: 102473167)     Exons: 15     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene interacts with components of the origin recognition complex (ORC) and regulates the formation of the prereplicative complex. The encoded protein stabilizes the ORC and therefore aids in DNA replication. This protein is req
• OMIM: 615167

Protein Summary

• Protein general information: Q9UFC0  
  • Name: Leucine rich repeat and WD repeat containing protein 1 (Centromere protein 33) (CENP 33) (Origin recognition complex associated protein) (ORC associated protein) (ORCA)
  • Length: 647  
  • Mass: 70,861
• Sequence:

  MGPLSARLLMQRGRPKSDRLGKIRSLDLSGLELLSEHLDPKLLCRLTQLQELDLSNNHLETLPDNLGLSHLRVLR
  CANNQLGDVTALCQFPKLEELSLEGNPFLTVNDNLKVSFLLPTLRKVNGKDASSTYSQVENLNRELTSRVTAHWE
  KFMATLGPEEEAEKAQADFVKSAVRDVRYGPESLSEFTQWRVRMISEELVAASRTQVQKANSPEKPPEAGAAHKP
  RARLAALKRPDDVPLSLSPSKRACASPSAQVEGSPVAGSDGSQPAVKLEPLHFLQCHSKNNSPQDLETQLWACAF
  EPAWEEGATSQTVATCGGEAVCVIDCQTGIVLHKYKAPGEEFFSVAWTALMVVTQAGHKKRWSVLAAAGLRGLVR
  LLHVRAGFCCGVIRAHKKAIATLCFSPAHETHLFTASYDKRIILWDIGVPNQDYEFQASQLLTLDTTSIPLRLCP
  VASCPDARLLAGCEGGCCCWDVRLDQPQKRRVCEVEFVFSEGSEASGRRVDGLAFVNEDIVASKGSGLGTICLWS
  WRQTWGGRGSQSTVAVVVLARLQWSSTELAYFSLSACPDKGIVLCGDEEGNVWLYDVSNILKQPPLLPAALQAPT
  QILKWPQPWALGQVVTKTMVNTVVANASFTYLTALTDSNIVAIWGRM

• Structural information:
  • Interpro: IPR001611  IPR025875  IPR003591  IPR032675  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS51450 PS00678 PS50082 PS50294
  • STRING: ENSP00000292616
• Other Databases: GeneCards:  LRWD1  Malacards:  LRWD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0006325	chromatin organization	IMP	biological process
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0031933	telomeric heterochromatin	IDA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0071169	establishment of protein localization to chromatin	IDA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006260	DNA replication	IEA	biological process
GO:0006270	DNA replication initiation	TAS	biological process
GO:0006325	chromatin organization	IMP	biological process
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0031933	telomeric heterochromatin	IDA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0071169	establishment of protein localization to chromatin	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0003682	chromatin binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005664	nuclear origin of replication recognition complex	IDA	cellular component
GO:0005721	pericentric heterochromatin	IDA	cellular component
GO:0006270	DNA replication initiation	TAS	biological process
GO:0006325	chromatin organization	IMP	biological process
GO:0008327	methyl-CpG binding	IDA	molecular function
GO:0031933	telomeric heterochromatin	IDA	cellular component
GO:0035064	methylated histone binding	IDA	molecular function
GO:0071169	establishment of protein localization to chromatin	IDA	biological process

Diseases

Associated diseases	References
Sertoli cell only syndrome (SCOS)	MIK: 23445371
Meiotic arrest	MIK: 23445371
Azoospermia	MIK: 23445371
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Meiotic arrest (MA)	MIK: 23445371

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
23445371	SCOS, azoospermia, meiotic arrest (MA)		Japanes e	230 (130 SCOS and meiotic arrest (MA), 100 healthy control men)	Male infertility
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq