• Gene id: 222068

Gene Summary

• Gene Symbol: TMED4   Gene   UCSC   Ensembl
• Aliases: ERS25, GMP25iso, HNLF, p24a3, p24alpha3
• Gene name: transmembrane p24 trafficking protein 4
• Alternate names: transmembrane emp24 domain-containing protein 4, endoplasmic reticulum stress-response protein 25 kDa, p24 family protein alpha-3, putative NF-kappa-B-activating protein 156, putative NFkB activating protein HNLF, transmembrane emp24 protein transport domain c,
• Gene location: 7p13 (44582294: 44577893)     Exons: 5     NC_000007.14
• OMIM: 603429

Protein Summary

• Protein general information: Q7Z7H5  
  • Name: Transmembrane emp24 domain containing protein 4 (Endoplasmic reticulum stress response protein 25) (ERS25) (GMP25iso) (Putative NF kappa B activating protein 156) (p24 family protein alpha 3) (p24alpha3)
  • Length: 227  
  • Mass: 25943
• Sequence:

  MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQMWDKQKEVFLPSTPGL
  GMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAK
  DKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKK
  LV

• Structural information:
  • Protein Domains: (39..13-)
    (/note="GOLD-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00096"-)
  • Interpro: IPR009038  IPR015720  
  • Prosite: PS50866
  • STRING: ENSP00000404042
• Other Databases: GeneCards:  TMED4  Malacards:  TMED4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0030134	COPII-coated ER to Golgi transport vesicle	IBA	cellular component
GO:0007030	Golgi organization	IBA	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	HMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq