• Gene id: 2219

Gene Summary

• Gene Symbol: FCN1   Gene   UCSC   Ensembl
• Aliases: FCNM
• Gene name: ficolin 1
• Alternate names: ficolin-1, M-ficolin, ficolin (collagen/fibrinogen domain-containing) 1, ficolin-A, ficolin-alpha,
• Gene location: 9q34.3 (134917911: 134903231)     Exons: 9     NC_000009.12
• Gene summary(Entrez): The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also foun
• OMIM: 601252

Protein Summary

• Protein general information: O00602  
  • Name: Ficolin 1 (Collagen/fibrinogen domain containing protein 1) (Ficolin A) (Ficolin alpha) (M ficolin)
  • Length: 326  
  • Mass: 35078
  • Tissue specificity: Peripheral blood leukocytes, monocytes and granulocytes. Also detected in spleen, lung, and thymus, may be due to the presence of tissue macrophages or trapped blood in these tissues. Not detected on lymphocytes. {ECO
• Sequence:

  MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGER
  GLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDT
  DGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKV
  ADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESY
  ANGINWSAAKGYKYSYKVSEMKVRPA

• Structural information:
  • Protein Domains: (55..9-)
    (/note="Collagen-like-)
    (109..32-)
    (/note="Fibrinogen-C-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00739"-)
  • Interpro: IPR008160  IPR036056  IPR014716  IPR014715  IPR002181   IPR020837  
  • Prosite: PS00514 PS51406
  • CDD: cd00087
  • PDB: 2D39 2JHH 2JHI 2JHK 2JHL 2JHM 2WNP
  • PDBsum: 2D39 2JHH 2JHI 2JHK 2JHL 2JHM 2WNP
  • STRING: ENSP00000360871
• Other Databases: GeneCards:  FCN1  Malacards:  FCN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003823	antigen binding	IBA	molecular function
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0001867	complement activation, lectin pathway	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0097367	carbohydrate derivative binding	IBA	molecular function
GO:0031232	extrinsic component of external side of plasma membrane	IDA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IDA	biological process
GO:0002752	cell surface pattern recognition receptor signaling pathway	IMP	biological process
GO:0001664	G protein-coupled receptor binding	IPI	molecular function
GO:0038187	pattern recognition receptor activity	IMP	molecular function
GO:2000484	positive regulation of interleukin-8 secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:1904813	ficolin-1-rich granule lumen	TAS	cellular component
GO:0001867	complement activation, lectin pathway	TAS	biological process
GO:0001867	complement activation, lectin pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0006956	complement activation	TAS	biological process
GO:0034774	secretory granule lumen	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097367	carbohydrate derivative binding	IEA	molecular function
GO:0033691	sialic acid binding	IEA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0046597	negative regulation of viral entry into host cell	IDA	biological process
GO:0033691	sialic acid binding	IDA	molecular function
GO:0043654	recognition of apoptotic cell	IDA	biological process
GO:0034394	protein localization to cell surface	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881