• Gene id: 2217

Gene Summary

• Gene Symbol: FCGRT   Gene   UCSC   Ensembl
• Aliases: FCRN, alpha-chain
• Gene name: Fc fragment of IgG receptor and transporter
• Alternate names: IgG receptor FcRn large subunit p51, Fc fragment of IgG, receptor, transporter, alpha, FcRn alpha chain, IgG Fc fragment receptor transporter alpha chain, heavy chain of the major histocompatibility complex class I-like Fc receptor, immunoglobulin receptor, in,
• Gene location: 19q13.33 (49512660: 49526427)     Exons: 7     NC_000019.10
• Gene summary(Entrez): This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from
• OMIM: 607216

Protein Summary

• Protein general information: P55899  
  • Name: IgG receptor FcRn large subunit p51 (FcRn) (IgG Fc fragment receptor transporter alpha chain) (Neonatal Fc receptor)
  • Length: 365  
  • Mass: 39743
  • Tissue specificity: Expressed in full-term placenta, heart, lung, liver, muscle, kidney, pancreas, and both fetal and adult small intestine. {ECO
• Sequence:

  MGVPRPQPWALGLLLFLLPGSLGAESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWV
  WENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTW
  GGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFS
  FYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSSVLV
  VGIVIGVLLLTAAAVGGALLWRRMRSGLPAPWISLRGDDTGVLLPTPGEAQDADLKDVNVIPATA

• Structural information:
  • Protein Domains: (202..28-)
    (/note="Ig-like-C1-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003006  IPR003597   IPR011161  IPR037055  IPR011162  
  • Prosite: PS50835 PS00290
  • PDB: 1EXU 3M17 3M1B 4K71 4N0F 4N0U 5BJT 5BXF 5WHK 6C97 6C98 6C99 6FGB 6ILM 6NHA
  • PDBsum: 1EXU 3M17 3M1B 4K71 4N0F 4N0U 5BJT 5BXF 5WHK 6C97 6C98 6C99 6FGB 6ILM 6NHA
  • DIP: 6165
  • STRING: ENSP00000221466
• Other Databases: GeneCards:  FCGRT  Malacards:  FCGRT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002476	antigen processing and presentation of endogenous peptide antigen via MHC class Ib	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0030881	beta-2-microglobulin binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0019864	IgG binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030881	beta-2-microglobulin binding	IEA	molecular function
GO:0042605	peptide antigen binding	ISS	NOT|molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0019864	IgG binding	IDA	molecular function
GO:0002416	IgG immunoglobulin transcytosis in epithelial cells mediated by FcRn immunoglobulin receptor	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq