• Gene id: 221662

Gene Summary

• Gene Symbol: RBM24   Gene   UCSC   Ensembl
• Aliases: RNPC6, dJ259A10.1
• Gene name: RNA binding motif protein 24
• Alternate names: RNA-binding protein 24, RNA-binding region (RNP1, RRM) containing 6, RNA-binding region-containing protein 6,
• Gene location: 6p22.3 (17281360: 17293874)     Exons: 7     NC_000006.12
• OMIM: 613276

Protein Summary

• Protein general information: Q9BX46  
  • Name: RNA binding protein 24 (RNA binding motif protein 24) (RNA binding region containing protein 6)
  • Length: 236  
  • Mass: 24776
  • Tissue specificity: Expressed in fetal and adult heart and skeletal muscles (PubMed
• Sequence:

  MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPI
  IDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVYPQAFVQPGVVIPHVQPTAAAASTTPYI
  DYTGAAYAQYSAAAAAAAAAAAYDQYPYAASPAAAGYVTAGGYGYAVQQPITAAAPGTAAAAAAAAAAAAAFGQY
  QPQQLQTDRMQ

• Structural information:
  • Protein Domains: (11..8-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR012677  IPR035979  IPR000504  
  • Prosite: PS50102
  • STRING: ENSP00000368341
• Other Databases: GeneCards:  RBM24  Malacards:  RBM24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0070935	3'-UTR-mediated mRNA stabilization	IBA	biological process
GO:0006397	mRNA processing	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990825	sequence-specific mRNA binding	IDA	molecular function
GO:1990715	mRNA CDS binding	IDA	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0097157	pre-mRNA intronic binding	ISS	molecular function
GO:1902811	positive regulation of skeletal muscle fiber differentiation	ISS	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	ISS	biological process
GO:0043488	regulation of mRNA stability	ISS	biological process
GO:0010830	regulation of myotube differentiation	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:1905870	positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	biological process
GO:2000738	positive regulation of stem cell differentiation	IMP	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:2000766	negative regulation of cytoplasmic translation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010831	positive regulation of myotube differentiation	IMP	biological process
GO:0048255	mRNA stabilization	IMP	biological process
GO:0061157	mRNA destabilization	IMP	biological process
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:1902811	positive regulation of skeletal muscle fiber differentiation	IEA	biological process
GO:0097157	pre-mRNA intronic binding	IEA	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0010830	regulation of myotube differentiation	IEA	biological process
GO:0003197	endocardial cushion development	IEA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0051252	regulation of RNA metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0070935	3'-UTR-mediated mRNA stabilization	IBA	biological process
GO:0006397	mRNA processing	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003723	RNA binding	IBA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IDA	molecular function
GO:1990825	sequence-specific mRNA binding	IDA	molecular function
GO:1990715	mRNA CDS binding	IDA	molecular function
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IMP	biological process
GO:0097157	pre-mRNA intronic binding	ISS	molecular function
GO:1902811	positive regulation of skeletal muscle fiber differentiation	ISS	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	ISS	biological process
GO:0043488	regulation of mRNA stability	ISS	biological process
GO:0010830	regulation of myotube differentiation	ISS	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:1905870	positive regulation of 3'-UTR-mediated mRNA stabilization	IMP	biological process
GO:2000738	positive regulation of stem cell differentiation	IMP	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:2000766	negative regulation of cytoplasmic translation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010831	positive regulation of myotube differentiation	IMP	biological process
GO:0048255	mRNA stabilization	IMP	biological process
GO:0061157	mRNA destabilization	IMP	biological process
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:1902811	positive regulation of skeletal muscle fiber differentiation	IEA	biological process
GO:0097157	pre-mRNA intronic binding	IEA	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0010830	regulation of myotube differentiation	IEA	biological process
GO:0003197	endocardial cushion development	IEA	biological process
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray