• Gene id: 2215

Gene Summary

• Gene Symbol: FCGR3B   Gene   UCSC   Ensembl
• Aliases: CD16, CD16A, CD16b, FCG3, FCGR3, FCGR3A, FCR-10, FCRIII, FCRIIIb
• Gene name: Fc fragment of IgG receptor IIIb
• Alternate names: low affinity immunoglobulin gamma Fc region receptor III-B, Fc fragment of IgG, low affinity IIIb, receptor (CD16b), Fc gamma receptor III-B, Fc gamma receptor IIIb, Fc-gamma receptor IIIb (CD 16), fc-gamma RIII-beta, fc-gamma RIIIb, igG Fc receptor III-1,
• Gene location: 1q23.3 (161631962: 161623195)     Exons: 7     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a low affinity receptor for the Fc region of gamma immunoglobulins (IgG). The encoded protein acts as a monomer and can bind either monomeric or aggregated IgG. This gene may function to capture immune complexes in the
• OMIM: 610665

Protein Summary

• Protein general information: O75015  
  • Name: Low affinity immunoglobulin gamma Fc region receptor III B (Fc gamma RIII beta) (Fc gamma RIII) (Fc gamma RIIIb) (FcRIII) (FcRIIIb) (FcR 10) (IgG Fc receptor III 1) (CD antigen CD16b)
  • Length: 233  
  • Mass: 26216
  • Tissue specificity: Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils.
• Sequence:

  MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYF
  IDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKY
  FHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGL
  YFSVKTNI

• Structural information:
  • Protein Domains: (40..9-)
    1 (/note="Ig-like-C2-type)
    (121..17-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 1E4J 1E4K 1FNL 1T83 1T89 6EAQ
  • PDBsum: 1E4J 1E4K 1FNL 1T83 1T89 6EAQ
  • STRING: ENSP00000433642
• Other Databases: GeneCards:  FCGR3B  Malacards:  FCGR3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050776	regulation of immune response	IBA	biological process
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0019864	IgG binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0006955	immune response	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04380	Osteoclast differentiation
hsa05322	Systemic lupus erythematosus
hsa04650	Natural killer cell mediated cytotoxicity
hsa04666	Fc gamma R-mediated phagocytosis
hsa05150	Staphylococcus aureus infection
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Systemic lupus erythematosus	KEGG:H00080
Systemic lupus erythematosus	KEGG:H00080
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)