• Gene id: 221477

Gene Summary

• Gene Symbol: C6orf89   Gene   UCSC   Ensembl
• Aliases: BRAP, PS1TP5TP1
• Gene name: chromosome 6 open reading frame 89
• Alternate names: bombesin receptor-activated protein C6orf89, amfion,
• Gene location: 6p21.2 (36834885: 36928963)     Exons: 17     NC_000006.12
• OMIM: 616642

Protein Summary

• Protein general information: Q6UWU4  
  • Name: Bombesin receptor activated protein C6orf89 (Amfion)
  • Length: 347  
  • Mass: 39870
• Sequence:

  MDLAANEISIYDKLSETVDLVRQTGHQCGMSEKAIEKFIRQLLEKNEPQRPPPQYPLLIVVYKVLATLGLILLTA
  YFVIQPFSPLAPEPVLSGAHTWRSLIHHIRLMSLPIAKKYMSENKGVPLHGGDEDRPFPDFDPWWTNDCEQNESE
  PIPANCTGCAQKHLKVMLLEDAPRKFERLHPLVIKTGKPLLEEEIQHFLCQYPEATEGFSEGFFAKWWRCFPERW
  FPFPYPWRRPLNRSQMLRELFPVFTHLPFPKDASLNKCSFLHPEPVVGSKMHKMPDLFIIGSGEAMLQLIPPFQC
  RRHCQSVAMPIEPGDIGYVDTTHWKVYVIARGVQPLVICDGTAFSEL

• Structural information:
  • Interpro: IPR038757  
  • STRING: ENSP00000347322
• Other Databases: GeneCards:  C6orf89  Malacards:  C6orf89

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045787	positive regulation of cell cycle	IDA	biological process
GO:0042060	wound healing	IDA	biological process
GO:0000139	Golgi membrane	IDA	cellular component
GO:0050673	epithelial cell proliferation	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0030496	midbody	IDA	cellular component
GO:1901727	positive regulation of histone deacetylase activity	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0030496	midbody	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq