• Gene id: 221476

Gene Summary

• Gene Symbol: PI16   Gene   UCSC   Ensembl
• Aliases: CD364, CRISP9, MSMBBP, PSPBP
• Gene name: peptidase inhibitor 16
• Alternate names: peptidase inhibitor 16, PSP94-binding protein, cysteine-rich secretory protein 9, microseminoprotein, beta-binding protein, protease inhibitor 16,
• Gene location: 6p21.2 (36948262: 36964836)     Exons: 8     NC_000006.12

Protein Summary

• Protein general information: Q6UXB8  
  • Name: Peptidase inhibitor 16 (PI 16) (Cysteine rich secretory protein 9) (CRISP 9) (PSP94 binding protein) (CD antigen CD364)
  • Length: 463  
  • Mass: 49471
  • Tissue specificity: Expressed in prostate, testis, ovary and intestine. Concentrates in prostate cancer patient's sera. {ECO
• Sequence:

  MHGSCSFLMLLLPLLLLLVATTGPVGALTDEEKRLMVELHNLYRAQVSPTASDMLHMRWDEELAAFAKAYARQCV
  WGHNKERGRRGENLFAITDEGMDVPLAMEEWHHEREHYNLSAATCSPGQMCGHYTQVVWAKTERIGCGSHFCEKL
  QGVEETNIELLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKNSLCEPIGSPEDAQDLPYLVTEAPSFRATEAS
  DSRKMGTPSSLATGIPAFLVTEVSGSLATKALPAVETQAPTSLATKDPPSMATEAPPCVTTEVPSILAAHSLPSL
  DEEPVTFPKSTHVPIPKSADKVTDKTKVPSRSPENSLDPKMSLTGARELLPHAQEEAEAEAELPPSSEVLASVFP
  AQDKPGELQATLDHTGHTSSKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHVWGPLLG
  LLLLPPLVLAGIF

• Structural information:
  • Protein Domains: (37..16-)
    (/note="SCP"-)
  • Interpro: IPR018244  IPR014044  IPR035940  IPR001283  
  • Prosite: PS01009 PS01010
  • STRING: ENSP00000362778
• Other Databases: GeneCards:  PI16  Malacards:  PI16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0061052	negative regulation of cell growth involved in cardiac muscle cell development	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray