• Gene id: 221458

Gene Summary

• Gene Symbol: KIF6   Gene   UCSC   Ensembl
• Aliases: C6orf102, dJ1043E3.1, dJ137F1.4, dJ188D3.1
• Gene name: kinesin family member 6
• Alternate names: kinesin-like protein KIF6,
• Gene location: 6p21.2 (39725422: 39329989)     Exons: 28     NC_000006.12
• Gene summary(Entrez): This gene encodes a member of a family of molecular motors which are involved in intracellular transport of protein complexes, membrane organelles, and messenger ribonucleic acid along microtubules. Kinesins function as homodimeric molecules with two N-te
• OMIM: 613919

Protein Summary

• Protein general information: Q6ZMV9  
  • Name: Kinesin like protein KIF6
  • Length: 814  
  • Mass: 92,569
• Sequence:

  MVKQTIQIFARVKPPVRKHQQGIYSIDEDEKLIPSLEIILPRDLADGFVNNKRESYKFKFQRIFDQDANQETVFE
  NIAKPVAGSVLAGYNGTIFAYGQTGSGKTFTITGGAERYSDRGIIPRTLSYIFEQLQKDSSKIYTTHISYLEIYN
  ECGYDLLDPRHEASSLEDLPKVTILEDPDQNIHLKNLTLHQATTEEEALNLLFLGDTNRMIAETPMNQASTRSHC
  IFTIHLSSKEPGSATVRHAKLHLVDLAGSERVAKTGVGGHLLTEAKYINLSLHYLEQVIIALSEKHRSHIPYRNS
  MMTSVLRDSLGGNCMTTMIATLSLEKRNLDESISTCRFAQRVALIKNEAVLNEEINPRLVIKRLQKEIQELKDEL
  AMVTGEQRTEALTEAELLQLEKLITSFLEDQDSDSRLEVGADMRKVHHCFHHLKKLLNDKKILENNTVSSESKDQ
  DCQEPLKEEEYRKLRDILKQRDNEINILVNMLKKEKKKAQEALHLAGMDRREFRQSQSPPFRLGNPEEGQRMRLS
  SAPSQAQDFSILGKRSSLLHKKIGMREEMSLGCQEAFEIFKRDHADSVTIDDNKQILKQRFSEAKALGESINEAR
  SKIGHLKEEITQRHIQQVALGISENMAVPLMPDQQEEKLRSQLEEEKRRYKTMFTRLKALKVEIEHLQLLMDKAK
  VKLQKEFEVWWAEEATNLQVNSPAVNSLDHTKPFLQTSDSQHEWSQLLSNKSSGGWEVQDQGTGRFDVCDVNARK
  ILPSPCPSPHSQKQSSTSTPLEDSIPKRPVSSIPLTGDSQTDSDIIAFIKARQSILQKQCLGSN

• Structural information:
  • Protein Domains: Kinesin (5-345)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • STRING: ENSP00000287152
• Other Databases: GeneCards:  KIF6  Malacards:  KIF6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005871	kinesin complex	IBA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0001673	male germ cell nucleus	IEA	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005871	kinesin complex	IBA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0007018	microtubule-based movement	IEA	biological process
GO:0007018	microtubule-based movement	IBA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005871	kinesin complex	IBA	cellular component
GO:0007018	microtubule-based movement	IBA	biological process
GO:0016887	ATPase activity	IBA	molecular function

Diseases

Associated diseases	References
Atherosclerosis	GAD: 20403483
Apoplexy	GAD: 19752551
Cardiovascular disease	GAD: 19023099
Brain ischemia	GAD: 19023099
Attention deficit hyperactivity disorder (ADHD)	GAD: 18846501
Asthenozoospermia	MIK: 21898990
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenospermia	MIK: 21898990
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21898990	Asthenospermia				Male infertility	KIF3B MYO15A KIF6 KIF26B KIF3A DNHD2 DMN DYNC2H1 STARD9 MYOHD1 and TPM1
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq