• Gene id: 221443

Gene Summary

• Gene Symbol: OARD1   Gene   UCSC   Ensembl
• Aliases: C6orf130, TARG1, dJ34B21.3
• Gene name: O-acyl-ADP-ribose deacylase 1
• Alternate names: ADP-ribose glycohydrolase OARD1, O-acetyl-ADP-ribose deacetylase 1, O-acetyl-ADP-ribose deacetylase C6orf130, [Protein ADP-ribosylglutamate] hydrolase OARD1, terminal ADP-ribose protein glycohydrolase 1,
• Gene location: 6p21.1 (41097786: 41064771)     Exons: 9     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a deacylase that can convert O-acetyl-ADP-ribose to ADP-ribose and acetate, O-propionyl-ADP-ribose to ADP-ribose and propionate, and O-butyryl-ADP-ribose to ADP-ribose and butyrate. The ADP-ribose product is able to inh
• OMIM: 614393

Protein Summary

• Protein general information: Q9Y530  
  • Name: ADP ribose glycohydrolase OARD1 (O acetyl ADP ribose deacetylase 1) (EC 3.5.1. ) (Terminal ADP ribose protein glycohydrolase 1) ([Protein ADP ribosylglutamate] hydrolase OARD1) (EC 3.2.2. )
  • Length: 152  
  • Mass: 17025
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDG
  RYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVY
  TL

• Structural information:
  • Protein Domains: (2..15-)
    (/note="Macro-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00490"-)
  • Interpro: IPR002589  
  • Prosite: PS51154
  • PDB: 2EEE 2L8R 2LGR 4J5Q 4J5R 4J5S
  • PDBsum: 2EEE 2L8R 2LGR 4J5Q 4J5R 4J5S
  • STRING: ENSP00000420484
• Other Databases: GeneCards:  OARD1  Malacards:  OARD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0140291	peptidyl-glutamate ADP-deribosylation	IBA	biological process
GO:0001883	purine nucleoside binding	IDA	molecular function
GO:0042278	purine nucleoside metabolic process	IDA	biological process
GO:0061463	O-acetyl-ADP-ribose deacetylase activity	IDA	molecular function
GO:0140291	peptidyl-glutamate ADP-deribosylation	IDA	biological process
GO:0140291	peptidyl-glutamate ADP-deribosylation	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0090734	site of DNA damage	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0140293	ADP-ribosylglutamate hydrolase activity	IDA	molecular function
GO:0140293	ADP-ribosylglutamate hydrolase activity	IDA	molecular function
GO:0051725	protein de-ADP-ribosylation	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)