• Gene id: 2214

Gene Summary

• Gene Symbol: FCGR3A   Gene   UCSC   Ensembl
• Aliases: CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20
• Gene name: Fc fragment of IgG receptor IIIa
• Alternate names: low affinity immunoglobulin gamma Fc region receptor III-A, CD16a antigen, Fc fragment of IgG, low affinity III, receptor for (CD16), Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc gamma receptor III-A, Fc-gamma RIII-alpha, Fc-gamma receptor ,
• Gene location: 1q23.3 (161550736: 161541758)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. This gene (FCGR3A) is highly similar to another
• OMIM: 146740

SNPs

rs397515340

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000006.12   g.43670919_43670921GAA[1]
NC_000006.12   g.43670919_43670921GAA[3]
NC_000006.11   g.43638656_43638658GAA[1]
NC_000006.11   g.43638656_43638658GAA[3]
NG_023436.1   g.30890_30892GAA[1]
NG_023436.1   g.30890_30892GAA[3]
NM_152732.5   c.801_803GAA[1]
NM  

Protein Summary

• Protein general information: P08637  
  • Name: Low affinity immunoglobulin gamma Fc region receptor III A (CD16a antigen) (Fc gamma RIII alpha) (Fc gamma RIII) (Fc gamma RIIIa) (FcRIII) (FcRIIIa) (FcR 10) (IgG Fc receptor III 2) (CD antigen CD16a)
  • Length: 254  
  • Mass: 29,089
• Sequence:

  MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYF
  IDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKY
  FHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGL
  YFSVKTNIRSSTRDWKDHKFKWRKDPQDK

• Structural information:
  • Protein Domains: Ig-like (24-105)
    Ig-like (107-189)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 3AY4 3SGJ 3SGK 3WN5 5BW7 5D6D 5ML9 5MN2 5XJE 5XJF
  • PDBsum: 3AY4 3SGJ 3SGK 3WN5 5BW7 5D6D 5ML9 5MN2 5XJE 5XJF
  • STRING: ENSP00000356946
• Other Databases: GeneCards:  FCGR3A  Malacards:  FCGR3A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019864	IgG binding	IEA	molecular function
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019864	IgG binding	IEA	molecular function
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04650	Natural killer cell mediated cytotoxicity
hsa04666	Fc gamma R-mediated phagocytosis
hsa04380	Osteoclast differentiation
hsa05322	Systemic lupus erythematosus
hsa05150	Staphylococcus aureus infection
hsa05152	Tuberculosis
hsa05140	Leishmaniasis

Diseases

Associated diseases	References
Cancer (colorectal)	GAD: 18349392
Cancer (gastric)	GAD: 20047592
Cancer (Kaposi's sarcoma)	GAD: 15767342
Cancer (leukemia)	GAD: 14563637
Cancer (lymphoma)	GAD: 15659493
Cancer (myeloma)	GAD: 18452102
Cancer (Neuroblastoma)	GAD: 20935224
Cancer (non-Hodgkin lymphoma)	GAD: 11806974
Brill-Symmers disease	GAD: 17650444
Cancer	GAD: 11806974
Cancer (B-Cell lymphomas)	GAD: 20730791
Cancer (Chronic Lymphocytic Leukemia)	GAD: 20705761
Cancer (Squamous cell)	GAD: 18979096
Cancer (breast)	GAD: 18347005
Atherosclerosis	GAD: 15910853
Cardiovascular disease	GAD: 11887471
Thrombocytopenia	GAD: 15191947
Thrombocytopenia	GAD: 12492589
Kawasaki disease	GAD: 16133986
Addison's disease	GAD: 17523948
Aggressive periodontitis	GAD: 19892918
Arthritis	GAD: 12379528
Asthma	GAD: 18199088
Autoimmune diseases	GAD: 21208440
Behcet's disease	GAD: 19026120
Immunodeficiency	GAD: 20664961
Rheumatoid arthritis	GAD: 11037893
Multiple sclerosis	GAD: 12864991
Systemic lupus erythematosus (SLE)	GAD: 12209518
Systemic lupus erythematosus (SLE)	GAD: 18625651
Systemic lupus erythematosus (SLE)	KEGG: H00080
Bullous pemphigoid	GAD: 17457599
Celiac disease	GAD: 19140833
Crohn's disease	GAD: 14987319
Myositis	GAD: 19493236
Still's disease	GAD: 11850593
Giant cell arteritis	GAD: 16846526
Stroke	GAD: 11835346
Myasthenia gravis	GAD: 14597109
Guillain-Barre syndrome	GAD: 15833371
Female infertility	INFBASE: 14505740
Infertility	INFBASE: 14568679
Recurrent pregnancy loss (RPL)	INFBASE: 10469717
Spontaneous abortion	INFBASE: 14505740
Nephropathy	GAD: 16221721
Idiopathic infertility	MIK: 14568679
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
14568679	Idiopathic infertility			40 (11 patients with idiopathic infertility (study group) with 29 patients in the control group (17 severe male factor infertility, 12 tubal factor infertility))	Male infertility, Female infertility	CD16 CD56
14568679	Idiopathic infertility			40 (11 patients with idiopathic infertility, 29 patients in the control group (17 severe male factor infertility, 12 tubal factor infertility))	Male infertility	CD16 CD56
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)