• Gene id: 221391

Gene Summary

• Gene Symbol: OPN5   Gene   UCSC   Ensembl
• Aliases: GPR136, GRP136, PGR12, TMEM13
• Gene name: opsin 5
• Alternate names: opsin-5, G-protein coupled receptor 136, neuropsin, transmembrane protein 13,
• Gene location: 6p12.3 (47782036: 47831087)     Exons: 12     NC_000006.12
• Gene summary(Entrez): Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. This opsin gene is expressed in the eye, brain, testes, and spinal cord. This gene belongs to the seven-exon subfamily of mammalian opsin genes that inc
• OMIM: 609042

Protein Summary

• Protein general information: Q6U736  
  • Name: Opsin 5 (G protein coupled receptor 136) (G protein coupled receptor PGR12) (Neuropsin) (Transmembrane protein 13)
  • Length: 354  
  • Mass: 39727
  • Tissue specificity: Detected in brain and retina and cell lines derived from neural retina. {ECO
• Sequence:

  MALNHTALPQDERLPHYLRDGDPFASKLSWEADLVAGFYLTIIGILSTFGNGYVLYMSSRRKKKLRPAEIMTINL
  AVCDLGISVVGKPFTIISCFCHRWVFGWIGCRWYGWAGFFFGCGSLITMTAVSLDRYLKICYLSYGVWLKRKHAY
  ICLAAIWAYASFWTTMPLVGLGDYVPEPFGTSCTLDWWLAQASVGGQVFILNILFFCLLLPTAVIVFSYVKIIAK
  VKSSSKEVAHFDSRIHSSHVLEMKLTKVAMLICAGFLIAWIPYAVVSVWSAFGRPDSIPIQLSVVPTLLAKSAAM
  YNPIIYQVIDYKFACCQTGGLKATKKKSLEGFRLHTVTTVRKSSAVLEIHEEWE

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR002962  IPR027430  
  • Prosite: PS00237 PS50262 PS00238
  • STRING: ENSP00000360255
• Other Databases: GeneCards:  OPN5  Malacards:  OPN5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071482	cellular response to light stimulus	IBA	biological process
GO:0008020	G protein-coupled photoreceptor activity	IBA	molecular function
GO:0007602	phototransduction	IBA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0001750	photoreceptor outer segment	IBA	cellular component
GO:0007601	visual perception	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0009881	photoreceptor activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0018298	protein-chromophore linkage	IEA	biological process
GO:0050896	response to stimulus	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007602	phototransduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005502	11-cis retinal binding	IEA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0009584	detection of visible light	IEA	biological process
GO:0009584	detection of visible light	IEA	biological process
GO:0005502	11-cis retinal binding	IMP	molecular function
GO:0007604	phototransduction, UV	IMP	biological process
GO:0043153	entrainment of circadian clock by photoperiod	ISS	biological process
GO:0008020	G protein-coupled photoreceptor activity	ISS	molecular function
GO:0007602	phototransduction	ISS	biological process
GO:0071482	cellular response to light stimulus	ISS	biological process
GO:1990384	hyaloid vascular plexus regression	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)