• Gene id: 2213

Gene Summary

• Gene Symbol: FCGR2B   Gene   UCSC   Ensembl
• Aliases: CD32, CD32B, FCG2, FCGR2, FCGR2C, FcRII-c, IGFR2
• Gene name: Fc fragment of IgG receptor IIb
• Alternate names: low affinity immunoglobulin gamma Fc region receptor II-b, CDw32, Fc fragment of IgG, low affinity II, receptor for (CD32), Fc fragment of IgG, low affinity IIb, receptor (CD32), Fc fragment of IgG, low affinity IIb, receptor for (CD32), Fc gamma RIIb, Fc gamma,
• Gene location: 1q23.3 (65059019: 65044817)     Exons: 19     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a low affinity receptor for the Fc region of immunoglobulin gamma complexes. The encoded protein is involved in the phagocytosis of immune complexes and in the regulation of antibody production by B-cells. Variations in
• OMIM: 604590

Protein Summary

• Protein general information: P31994  
  • Name: Low affinity immunoglobulin gamma Fc region receptor II b (IgG Fc receptor II b) (CDw32) (Fc gamma RII b) (Fc gamma RIIb) (FcRII b) (CD antigen CD32)
  • Length: 310  
  • Mass: 34044
  • Tissue specificity: Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cel
• Sequence:

  MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTH
  SPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVL
  RCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGII
  VAVVTGIAVAAIVAAVVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
  LEEPDDQNRI

• Structural information:
  • Protein Domains: (48..12-)
    1 (/note="Ig-like-C2-type)
    (131..21-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598  
  • Prosite: PS50835
  • PDB: 2FCB 3WJJ 5OCC
  • PDBsum: 2FCB 3WJJ 5OCC
  • DIP: 36638
  • STRING: ENSP00000351497
• Other Databases: GeneCards:  FCGR2B  Malacards:  FCGR2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006898	receptor-mediated endocytosis	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0019864	IgG binding	IDA	molecular function
GO:0001540	amyloid-beta binding	IPI	molecular function
GO:0019772	low-affinity IgG receptor activity	IDA	molecular function
GO:0001540	amyloid-beta binding	TAS	molecular function
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	IDA	biological process
GO:0002605	negative regulation of dendritic cell antigen processing and presentation	TAS	biological process
GO:0002819	regulation of adaptive immune response	TAS	biological process
GO:0002924	negative regulation of humoral immune response mediated by circulating immunoglobulin	ISS	biological process
GO:0002638	negative regulation of immunoglobulin production	ISS	biological process
GO:0006952	defense response	ISS	biological process
GO:0009617	response to bacterium	ISS	biological process
GO:0044877	protein-containing complex binding	IPI	molecular function
GO:1902564	negative regulation of neutrophil activation	TAS	biological process
GO:1904646	cellular response to amyloid-beta	ISS	biological process
GO:1901216	positive regulation of neuron death	ISS	biological process
GO:0002865	negative regulation of acute inflammatory response to antigenic stimulus	ISS	biological process
GO:0002922	positive regulation of humoral immune response	TAS	biological process
GO:0002622	regulation of B cell antigen processing and presentation	TAS	biological process
GO:0006911	phagocytosis, engulfment	ISS	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:1902950	regulation of dendritic spine maintenance	IGI	biological process
GO:0045088	regulation of innate immune response	TAS	biological process
GO:0010469	regulation of signaling receptor activity	TAS	biological process
GO:0043031	negative regulation of macrophage activation	TAS	biological process
GO:0045576	mast cell activation	ISS	NOT|biological process
GO:0043318	negative regulation of cytotoxic T cell degranulation	TAS	biological process
GO:2001199	negative regulation of dendritic cell differentiation	TAS	biological process
GO:1905898	positive regulation of response to endoplasmic reticulum stress	ISS	biological process
GO:0002313	mature B cell differentiation involved in immune response	TAS	biological process
GO:0050710	negative regulation of cytokine secretion	TAS	biological process
GO:0002316	follicular B cell differentiation	TAS	biological process
GO:0050765	negative regulation of phagocytosis	TAS	biological process
GO:0050869	negative regulation of B cell activation	TAS	biological process
GO:0009897	external side of plasma membrane	ISS	cellular component
GO:0071219	cellular response to molecule of bacterial origin	ISS	biological process
GO:0030889	negative regulation of B cell proliferation	ISS	biological process
GO:0001811	negative regulation of type I hypersensitivity	ISS	biological process
GO:0001814	negative regulation of antibody-dependent cellular cytotoxicity	TAS	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	ISS	biological process
GO:0016064	immunoglobulin mediated immune response	ISS	biological process
GO:0002436	immune complex clearance by monocytes and macrophages	TAS	biological process
GO:0046330	positive regulation of JNK cascade	ISS	biological process
GO:0002266	follicular dendritic cell activation	TAS	biological process
GO:0050859	negative regulation of B cell receptor signaling pathway	IMP	biological process
GO:0050766	positive regulation of phagocytosis	ISS	biological process
GO:0050777	negative regulation of immune response	ISS	biological process
GO:0032693	negative regulation of interleukin-10 production	ISS	biological process
GO:0090264	regulation of immune complex clearance by monocytes and macrophages	TAS	biological process
GO:0050776	regulation of immune response	IBA	biological process
GO:0007166	cell surface receptor signaling pathway	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0004888	transmembrane signaling receptor activity	IBA	molecular function
GO:0019864	IgG binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0006955	immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0021549	cerebellum development	ISS	biological process
GO:0044297	cell body	ISS	cellular component
GO:0043197	dendritic spine	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa04380	Osteoclast differentiation
hsa05162	Measles
hsa04666	Fc gamma R-mediated phagocytosis
hsa04662	B cell receptor signaling pathway
hsa05150	Staphylococcus aureus infection

Diseases

Associated diseases	References
Systemic lupus erythematosus	KEGG:H00080
Systemic lupus erythematosus	KEGG:H00080
Lymphocytic leukemia	PMID:20705761
Autoimmune thrombocytopenic purpura	PMID:21131591
Autoimmune thrombocytopenic purpura	PMID:15566359
Autoimmune thrombocytopenic purpura	PMID:19549396
Systemic lupus erythematosus	PMID:15153543
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R