• Gene id: 221120

Gene Summary

• Gene Symbol: ALKBH3   Gene   UCSC   Ensembl
• Aliases: ABH3, DEPC-1, DEPC1, PCA1, hABH3
• Gene name: alkB homolog 3, alpha-ketoglutarate dependent dioxygenase
• Alternate names: alpha-ketoglutarate-dependent dioxygenase alkB homolog 3, alkB homolog 3, alpha-ketoglutaratedependent dioxygenase, alkB, alkylation repair homolog 3, alkylated DNA repair protein alkB homolog 3, prostate cancer antigen-1,
• Gene location: 11p11.2 (43880830: 43920273)     Exons: 10     NC_000011.10
• Gene summary(Entrez): The Escherichia coli AlkB protein protects against the cytotoxicity of methylating agents by repair of the specific DNA lesions generated in single-stranded DNA. ALKBH2 (MIM 610602) and ALKBH3 are E. coli AlkB homologs that catalyze the removal of 1-methy
• OMIM: 617463

Protein Summary

• Protein general information: Q96Q83  
  • Name: Alpha ketoglutarate dependent dioxygenase alkB homolog 3 (EC 1.14.11.54) (Alkylated DNA repair protein alkB homolog 3) (hABH3) (DEPC 1) (Prostate cancer antigen 1)
  • Length: 286  
  • Mass: 33375
  • Tissue specificity: Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon. {ECO
• Sequence:

  MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIDRE
  GVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDITYQQPRLTAWYGELPYTYSRITMEP
  NPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEE
  NGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW

• Structural information:
  • Protein Domains: (172..27-)
    (/note="Fe2OG-dioxygenase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00805"-)
  • Interpro: IPR027450  IPR037151  IPR032854  IPR005123  
  • Prosite: PS51471
  • PDB: 2IUW
  • PDBsum: 2IUW
  • STRING: ENSP00000302232
• Other Databases: GeneCards:  ALKBH3  Malacards:  ALKBH3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0035553	oxidative single-stranded RNA demethylation	IDA	biological process
GO:0035553	oxidative single-stranded RNA demethylation	IDA	biological process
GO:0043734	DNA-N1-methyladenine dioxygenase activity	IDA	molecular function
GO:0006281	DNA repair	IDA	biological process
GO:1990930	RNA N1-methyladenosine dioxygenase activity	IDA	molecular function
GO:1990930	RNA N1-methyladenosine dioxygenase activity	IDA	molecular function
GO:0035552	oxidative single-stranded DNA demethylation	IDA	biological process
GO:0008198	ferrous iron binding	IDA	molecular function
GO:0006307	DNA dealkylation involved in DNA repair	IDA	biological process
GO:0006307	DNA dealkylation involved in DNA repair	IDA	biological process
GO:0043734	DNA-N1-methyladenine dioxygenase activity	IMP	molecular function
GO:0035552	oxidative single-stranded DNA demethylation	IMP	biological process
GO:0008283	cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006307	DNA dealkylation involved in DNA repair	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0035552	oxidative single-stranded DNA demethylation	IEA	biological process
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0031418	L-ascorbic acid binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0051213	dioxygenase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006307	DNA dealkylation involved in DNA repair	TAS	biological process
GO:0006307	DNA dealkylation involved in DNA repair	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051747	cytosine C-5 DNA demethylase activity	IEA	molecular function
GO:0016706	2-oxoglutarate-dependent dioxygenase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881