• Gene id: 221079

Gene Summary

• Gene Symbol: ARL5B   Gene   UCSC   Ensembl
• Aliases: ARL8
• Gene name: ADP ribosylation factor like GTPase 5B
• Alternate names: ADP-ribosylation factor-like protein 5B, ADP-ribosylation factor-like 5B, ADP-ribosylation factor-like 8, ADP-ribosylation factor-like protein 8, ADP-ribosylation-like factor 8,
• Gene location: 10p12.31 (18659334: 18681638)     Exons: 7     NC_000010.11
• Gene summary(Entrez): ARL5B (ARL8) belongs to a family of proteins that are structurally similar to ADP-ribosylation factors (ARFs; see MIM 103180). ARLs and ARFs are part of the RAS superfamily of regulatory GTPases.[supplied by OMIM, Nov 2010]
• OMIM: 615733

Protein Summary

• Protein general information: Q96KC2  
  • Name: ADP ribosylation factor like protein 5B (ADP ribosylation factor like protein 8)
  • Length: 179  
  • Mass: 20375
• Sequence:

  MGLIFAKLWSLFCNQEHKVIIVGLDNAGKTTILYQFLMNEVVHTSPTIGSNVEEIVVKNTHFLMWDIGGQESLRS
  SWNTYYSNTEFIILVVDSIDRERLAITKEELYRMLAHEDLRKAAVLIFANKQDMKGCMTAAEISKYLTLSSIKDH
  PWHIQSCCALTGEGLCQGLEWMTSRIGVR

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR006689  
  • Prosite: PS51417
  • PDB: 1YZG
  • PDBsum: 1YZG
  • STRING: ENSP00000366487
• Other Databases: GeneCards:  ARL5B  Malacards:  ARL5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IBA	molecular function
GO:0005802	trans-Golgi network	IBA	cellular component
GO:0016192	vesicle-mediated transport	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:1903292	protein localization to Golgi membrane	IBA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:1903292	protein localization to Golgi membrane	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R