• Gene id: 221074

Gene Summary

• Gene Symbol: SLC39A12   Gene   UCSC   Ensembl
• Aliases: LZT-Hs8, ZIP-12, bA570F3.1
• Gene name: solute carrier family 39 member 12
• Alternate names: zinc transporter ZIP12, LIV-1 subfamily of ZIP zinc transporter 8, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, zrt- and Irt-like protein 12,
• Gene location: 10p12.33 (17951838: 18043291)     Exons: 13     NC_000010.11
• Gene summary(Entrez): Zinc is an essential cofactor for hundreds of enzymes. It is involved in protein, nucleic acid, carbohydrate, and lipid metabolism, as well as in the control of gene transcription, growth, development, and differentiation. SLC39A12 belongs to a subfamily
• OMIM: 608734

Protein Summary

• Protein general information: Q504Y0  
  • Name: Zinc transporter ZIP12 (LIV 1 subfamily of ZIP zinc transporter 8) (LZT Hs8) (Solute carrier family 39 member 12) (Zrt and Irt like protein 12) (ZIP 12)
  • Length: 691  
  • Mass: 76666
  • Tissue specificity: Expressed in brain and eye. {ECO
• Sequence:

  MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNHSRSLIKTLLEKTGCP
  RRRNGMQGDCNLCFEPDALLLIAGGNFEDQLREEVVQRVSLLLLYYIIHQEEICSSKLNMSNKEYKFYLHSLLSL
  RQDEDSSFLSQNETEDILAFTRQYFDTSQSQCMETKTLQKKSGIVSSEGANESTLPQLAAMIITLSLQGVCLGQG
  NLPSPDYFTEYIFSSLNRTNTLRLSELDQLLNTLWTRSTCIKNEKIHQFQRKQNNIITHDQDYSNFSSSMEKESE
  DGPVSWDQTCFSARQLVEIFLQKGLSLISKEDFKQMSPGIIQQLLSCSCHLPKDQQAKLPPTTLEKYGYSTVAVT
  LLTLGSMLGTALVLFHSCEENYRLILQLFVGLAVGTLSGDALLHLIPQVLGLHKQEAPEFGHFHESKGHIWKLMG
  LIGGIHGFFLIEKCFILLVSPNDKQGLSLVNGHVGHSHHLALNSELSDQAGRGKSASTIQLKSPEDSQAAEMPIG
  SMTASNRKCKAISLLAIMILVGDSLHNFADGLAIGAAFSSSSESGVTTTIAILCHEIPHEMGDFAVLLSSGLSMK
  TAILMNFISSLTAFMGLYIGLSVSADPCVQDWIFTVTAGMFLYLSLVEMLPEMTHVQTQRPWMMFLLQNFGLILG
  WLSLLLLAIYEQNIKI

• Structural information:
  • Interpro: IPR003689  IPR041137  
  • STRING: ENSP00000366586
• Other Databases: GeneCards:  SLC39A12  Malacards:  SLC39A12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0006882	cellular zinc ion homeostasis	IBA	biological process
GO:0007165	signal transduction	IBA	biological process
GO:0071578	zinc ion import across plasma membrane	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0071578	zinc ion import across plasma membrane	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0031113	regulation of microtubule polymerization	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:1903561	extracellular vesicle	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq