• Gene id: 220972

Gene Summary

• Gene Symbol: MARCHF8   Gene   UCSC   Ensembl
• Aliases: CMIR, MARCH-VIII, MARCH8, MIR, RNF178, c-MIR
• Gene name: membrane associated ring-CH-type finger 8
• Alternate names: E3 ubiquitin-protein ligase MARCHF8, E3 ubiquitin-protein ligase MARCH8, RING finger protein 178, RING-type E3 ubiquitin transferase MARCH8, RING-type E3 ubiquitin transferase MARCHF8, c-mir, cellular modulator of immune recognition, cellular modulator of immun,
• Gene location: 10q11.21-q11.22 (45594905: 45454584)     Exons: 13     NC_000010.11
• Gene summary(Entrez): MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. M
• OMIM: 613880

Protein Summary

• Protein general information: Q5T0T0  
  • Name: E3 ubiquitin protein ligase MARCHF8 (EC 2.3.2.27) (Cellular modulator of immune recognition) (c MIR) (Membrane associated RING finger protein 8) (Membrane associated RING CH protein VIII) (MARCH VIII) (RING finger protein 178) (RING type E3 ubiquitin tran
  • Length: 291  
  • Mass: 32965
  • Tissue specificity: Broadly expressed. Present in immature dendritic cells (at protein level). {ECO
• Sequence:

  MSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNISKAGSPPSASAPAPVSSFSRTSITPS
  SQDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSS
  ERRKIMCSVTFHVIAITCVVWSLYVLIDRTAEEIKQGQATGILEWPFWTKLVVVAIGFTGGLLFMYVQCKVYVQL
  WKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • PDB: 2D8S
  • PDBsum: 2D8S
  • STRING: ENSP00000411848
• Other Databases: GeneCards:  MARCHF8  Malacards:  MARCHF8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0031902	late endosome membrane	IBA	cellular component
GO:0031901	early endosome membrane	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0042287	MHC protein binding	IBA	molecular function
GO:0006955	immune response	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0002495	antigen processing and presentation of peptide antigen via MHC class II	IBA	biological process
GO:0000209	protein polyubiquitination	IBA	biological process
GO:0008270	zinc ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0002376	immune system process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0000209	protein polyubiquitination	IDA	biological process
GO:0005768	endosome	IDA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function
GO:0004842	ubiquitin-protein transferase activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)