• Gene id: 220963

Gene Summary

• Gene Symbol: SLC16A9   Gene   UCSC   Ensembl
• Aliases: C10orf36, MCT9
• Gene name: solute carrier family 16 member 9
• Alternate names: monocarboxylate transporter 9, MCT 9, monocarboxylic acid transporter 9, solute carrier family 16 (monocarboxylic acid transporters), member 9,
• Gene location: 10q21.2 (59710078: 59650763)     Exons: 11     NC_000010.11
• OMIM: 614242

Protein Summary

• Protein general information: Q7RTY1  
  • Name: Monocarboxylate transporter 9 (MCT 9) (Solute carrier family 16 member 9)
  • Length: 509  
  • Mass: 55794
• Sequence:

  MELKKSPDGGWGWVIVFVSFLTQFLCYGSPLAVGVLYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSS
  FGARPVTIFSGFMVAGGLMLSSFAPNIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVG
  LFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDLPDKYSIYNEKGKNLEENI
  NILDKSYSSEEKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVAL
  FKNKVFSALFIAILLFDIGGFPPSLLMEDVARSSNVKEEEFIMPLISIIGIMTAVGKLLLGILADFKWINTLYLY
  VATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGNWSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIV
  GWFYDWTQTYDIAFYFSGFCVLLGGFILLLAALPSWDTCNKQLPKPAPTTFLYKVASNV

• Structural information:
  • Interpro: IPR030767  IPR011701  IPR020846  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000378757
• Other Databases: GeneCards:  SLC16A9  Malacards:  SLC16A9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008028	monocarboxylic acid transmembrane transporter activity	IBA	molecular function
GO:0016021	integral component of membrane	IBA	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015293	symporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046415	urate metabolic process	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0015718	monocarboxylic acid transport	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)