• Gene id: 2208

Gene Summary

• Gene Symbol: FCER2   Gene   UCSC   Ensembl
• Aliases: BLAST-2, CD23, CD23A, CLEC4J, FCE2, IGEBF
• Gene name: Fc fragment of IgE receptor II
• Alternate names: low affinity immunoglobulin epsilon Fc receptor, C-type lectin domain family 4, member J, CD23 antigen, Fc epsilon receptor II, Fc fragment of IgE, low affinity II, receptor for (CD23), fc-epsilon-RII, immunoglobulin E-binding factor, immunoglobulin epsilon-chai,
• Gene location: 19p13.2 (7702754: 7688756)     Exons: 12     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, the
• OMIM: 607263

Protein Summary

• Protein general information: P06734  
  • Name: Low affinity immunoglobulin epsilon Fc receptor (BLAST 2) (C type lectin domain family 4 member J) (Fc epsilon RII) (Immunoglobulin E binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc recepto
  • Length: 321  
  • Mass: 36469
• Sequence:

  MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHH
  GDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRM
  ELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRN
  LDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESM
  GPDSRPDPDGRLPTPSAPLHS

• Structural information:
  • Protein Domains: (162..28-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR018378  IPR033989  IPR016187  
  • Prosite: PS00615 PS50041
  • CDD: cd03590
  • PDB: 1HLI 1KJE 1T8C 1T8D 2H2R 2H2T 4EZM 4G96 4G9A 4GI0 4GJ0 4GJX 4GK1 4GKO 4J6J 4J6K 4J6L 4J6M 4J6N 4J6P 4J6Q 4KI1 5LGK
  • PDBsum: 1HLI 1KJE 1T8C 1T8D 2H2R 2H2T 4EZM 4G96 4G9A 4GI0 4GJ0 4GJX 4GK1 4GKO 4J6J 4J6K 4J6L 4J6M 4J6N 4J6P 4J6Q 4KI1 5LGK
  • STRING: ENSP00000264072
• Other Databases: GeneCards:  FCER2  Malacards:  FCER2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019863	IgE binding	IEA	molecular function
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005178	integrin binding	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007219	Notch signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0002925	positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA	biological process
GO:0051712	positive regulation of killing of cells of other organism	IDA	biological process
GO:0051000	positive regulation of nitric-oxide synthase activity	IDA	biological process
GO:0051770	positive regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05169	Epstein-Barr virus infection
hsa04640	Hematopoietic cell lineage

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq