• Gene id: 2207

Gene Summary

• Gene Symbol: FCER1G   Gene   UCSC   Ensembl
• Aliases: FCRG
• Gene name: Fc fragment of IgE receptor Ig
• Alternate names: high affinity immunoglobulin epsilon receptor subunit gamma, Fc epsilon receptor Ig, Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Fc receptor gamma-chain, fc-epsilon RI-gamma, fcRgamma, fceRI gamma, immunoglobulin E receptor, high affini,
• Gene location: 1q23.3 (161215294: 161219244)     Exons: 5     NC_000001.11
• Gene summary(Entrez): The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
• OMIM: 608405

Protein Summary

• Protein general information: P30273  
  • Name: High affinity immunoglobulin epsilon receptor subunit gamma (Fc receptor gamma chain) (FcRgamma) (Fc epsilon RI gamma) (IgE Fc receptor subunit gamma) (FceRI gamma)
  • Length: 86  
  • Mass: 9667
• Sequence:

  MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQET
  YETLKHEKPPQ

• Structural information:
  • Protein Domains: (54..8-)
    (/note="ITAM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00379"-)
  • Interpro: IPR021663  IPR042340  IPR003110  
  • Prosite: PS51055
  • DIP: 29514
  • STRING: ENSP00000289902
• Other Databases: GeneCards:  FCER1G  Malacards:  FCER1G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002292	T cell differentiation involved in immune response	IBA	biological process
GO:0010543	regulation of platelet activation	IBA	biological process
GO:0019767	IgE receptor activity	IBA	molecular function
GO:0019864	IgG binding	IBA	molecular function
GO:0030593	neutrophil chemotaxis	IBA	biological process
GO:0038094	Fc-gamma receptor signaling pathway	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0002283	neutrophil activation involved in immune response	IBA	biological process
GO:0002431	Fc receptor mediated stimulatory signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0016064	immunoglobulin mediated immune response	IBA	biological process
GO:0019863	IgE binding	IBA	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA	biological process
GO:0032998	Fc-epsilon receptor I complex	IBA	cellular component
GO:0042590	antigen processing and presentation of exogenous peptide antigen via MHC class I	IBA	biological process
GO:0042742	defense response to bacterium	IBA	biological process
GO:0050766	positive regulation of phagocytosis	IBA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	IMP	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	ISS	biological process
GO:0032753	positive regulation of interleukin-4 production	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0031623	receptor internalization	ISS	biological process
GO:0038156	interleukin-3-mediated signaling pathway	ISS	biological process
GO:0019767	IgE receptor activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0032998	Fc-epsilon receptor I complex	IEA	cellular component
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0019863	IgE binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0070821	tertiary granule membrane	TAS	cellular component
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0030168	platelet activation	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0072659	protein localization to plasma membrane	IEA	biological process
GO:0071404	cellular response to low-density lipoprotein particle stimulus	IEA	biological process
GO:0050778	positive regulation of immune response	IEA	biological process
GO:0050776	regulation of immune response	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0043306	positive regulation of mast cell degranulation	IEA	biological process
GO:0038094	Fc-gamma receptor signaling pathway	IEA	biological process
GO:0032755	positive regulation of interleukin-6 production	IEA	biological process
GO:0032753	positive regulation of interleukin-4 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0032623	interleukin-2 production	IEA	biological process
GO:0030593	neutrophil chemotaxis	IEA	biological process
GO:0019864	IgG binding	IEA	molecular function
GO:0019767	IgE receptor activity	IEA	molecular function
GO:0010543	regulation of platelet activation	IEA	biological process
GO:0007229	integrin-mediated signaling pathway	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0002292	T cell differentiation involved in immune response	IEA	biological process
GO:0001805	positive regulation of type III hypersensitivity	IEA	biological process
GO:0001798	positive regulation of type IIa hypersensitivity	IEA	biological process
GO:2000010	positive regulation of protein localization to cell surface	IEA	biological process
GO:0050766	positive regulation of phagocytosis	IEA	biological process
GO:0045576	mast cell activation	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0042742	defense response to bacterium	IEA	biological process
GO:0042590	antigen processing and presentation of exogenous peptide antigen via MHC class I	IEA	biological process
GO:0038156	interleukin-3-mediated signaling pathway	IEA	biological process
GO:0033026	negative regulation of mast cell apoptotic process	IEA	biological process
GO:0032998	Fc-epsilon receptor I complex	IEA	cellular component
GO:0032765	positive regulation of mast cell cytokine production	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0031623	receptor internalization	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	IEA	biological process
GO:0019863	IgE binding	IEA	molecular function
GO:0016064	immunoglobulin mediated immune response	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0006911	phagocytosis, engulfment	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0002554	serotonin secretion by platelet	IEA	biological process
GO:0002431	Fc receptor mediated stimulatory signaling pathway	IEA	biological process
GO:0002283	neutrophil activation involved in immune response	IEA	biological process
GO:0001812	positive regulation of type I hypersensitivity	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04072	Phospholipase D signaling pathway
hsa05152	Tuberculosis
hsa04611	Platelet activation
hsa04071	Sphingolipid signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa04625	C-type lectin receptor signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05310	Asthma

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R