• Gene id: 2206

Gene Summary

• Gene Symbol: MS4A2   Gene   UCSC   Ensembl
• Aliases: APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER, MS4A1
• Gene name: membrane spanning 4-domains A2
• Alternate names: high affinity immunoglobulin epsilon receptor subunit beta, Fc fragment of IgE, high affinity I, receptor for; beta polypeptide, High affinity immunoglobulin epsilon receptor beta-subunit (FcERI) (IgE Fc receptor, beta-subunit) (Fc epsilon receptor I beta-c,
• Gene location: 11q12.1 (60088260: 60098466)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-l
• OMIM: 601652

Protein Summary

• Protein general information: Q01362  
  • Name: High affinity immunoglobulin epsilon receptor subunit beta (FcERI) (Fc epsilon receptor I beta chain) (IgE Fc receptor subunit beta) (Membrane spanning 4 domains subfamily A member 2)
  • Length: 244  
  • Mass: 26534
  • Tissue specificity: Found on the surface of mast cells and basophils.
• Sequence:

  MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEFLGVTQILTAMICLCF
  GTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISERRNATYLVRGSLGANTASSIAGGTGITILII
  NLKKSLAYIHIHSCQKFFETKCFMASFSTEIVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIY
  SATYSELEDPGEMSPPIDL

• Structural information:
  • Interpro: IPR007237  IPR030417  IPR030420  
  • STRING: ENSP00000278888
• Other Databases: GeneCards:  MS4A2  Malacards:  MS4A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0038095	Fc-epsilon receptor signaling pathway	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006954	inflammatory response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0032998	Fc-epsilon receptor I complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019863	IgE binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0007166	cell surface receptor signaling pathway	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0019863	IgE binding	IEA	molecular function
GO:0032998	Fc-epsilon receptor I complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006955	immune response	IMP	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04072	Phospholipase D signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04664	Fc epsilon RI signaling pathway
hsa05310	Asthma

Diseases

Associated diseases	References
Asthma	KEGG:H00079
Asthma	KEGG:H00079
Asthma	PMID:19218813
Atopic dermatitis	PMID:8817330
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R